Advanced Search (OLGA)

Gene: Foxd4 (forkhead box D4) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Foxd4

Name:

forkhead box D4

RGD ID:

1614459

MGI Page

MGI

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in anatomical structure morphogenesis; cell differentiation; and regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Is expressed in several structures, including central nervous system; embryo endoderm; embryo mesoderm; lung; and neural ectoderm. Orthologous to several human genes including FOXD4 (forkhead box D4).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fkh2; forkhead box protein D4; forkhead homolog 2; forkhead-related protein FKHL9; forkhead-related transcription factor 5; FREA; FREAC-5; FREAC5; transcription factor FKH-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXD4 (forkhead box D4)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Foxd4 (forkhead box D4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Foxd4 (forkhead box D4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FOXD4 (forkhead box D4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxd4 (forkhead box D4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXD4 (forkhead box D4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxd4 (forkhead box D4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FOXD4L1 (forkhead box D4 like 1)	HGNC	Ensembl, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Homo sapiens (human):	FOXD4L3 (forkhead box D4 like 3)	HGNC	Ensembl, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):	FOXD4L5 (forkhead box D4 like 5)	HGNC	Ensembl, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):	FOXD4L6 (forkhead box D4 like 6)	HGNC	EggNOG, Ensembl, OMA, OrthoDB, Panther, PhylomeDB
Homo sapiens (human):	FOXD4L4 (forkhead box D4 like 4)	HGNC	Ensembl, OMA, OrthoDB, Panther, Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Foxd4 (forkhead box D4)	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FOXD4 (forkhead box D4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FOXD4L1 (forkhead box D4 like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FOXD4L4 (forkhead box D4 like 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	FOXD4L6 (forkhead box D4 like 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	FOXD4L3 (forkhead box D4 like 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	FOXD4L5 (forkhead box D4 like 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-130	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	24,876,307 - 24,878,380 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	24,876,600 - 24,878,561 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	24,898,943 - 24,901,016 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	24,899,236 - 24,901,197 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	24,973,455 - 24,975,799 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	24,966,062 - 24,968,406 (-)	NCBI		MGSCv36	mm8
Celera	19	25,674,165 - 25,676,509 (-)	NCBI		Celera
Cytogenetic Map	19	B	NCBI
cM Map	19	19.86	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Foxd4	Mouse	chromosome 9p deletion syndrome		ISO	FOXD4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 9p deletion syndrome	ClinVar	PMID:25741868
Foxd4	Mouse	schizophrenia		ISO	FOXD4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Foxd4	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of FOXD4 mRNA	CTD	PMID:21570461 and PMID:24058054
Foxd4	Mouse	3,3',4,4',5-pentachlorobiphenyl	decreases expression	ISO	FOXD4 (Homo sapiens)	6480464	3 more ...	CTD	PMID:23146750
Foxd4	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of FOXD4 mRNA	CTD	PMID:30951980
Foxd4	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	Foxd4 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of FOXD4 mRNA	CTD	PMID:24780913
Foxd4	Mouse	6-propyl-2-thiouracil	increases expression	ISO	Foxd4 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of FOXD4 mRNA	CTD	PMID:30047161
Foxd4	Mouse	aflatoxin B1	decreases methylation	ISO	FOXD4 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of FOXD4 gene	CTD	PMID:27153756
Foxd4	Mouse	amitrole	increases expression	ISO	Foxd4 (Rattus norvegicus)	6480464	Amitrole results in increased expression of FOXD4 mRNA	CTD	PMID:30047161
Foxd4	Mouse	ammonium chloride	affects expression	ISO	Foxd4 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of FOXD4 mRNA	CTD	PMID:16483693
Foxd4	Mouse	antirheumatic drug	decreases expression	ISO	FOXD4 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of FOXD4 mRNA	CTD	PMID:24449571
Foxd4	Mouse	aristolochic acid A	increases expression	ISO	FOXD4 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of FOXD4 mRNA	CTD	PMID:33212167
Foxd4	Mouse	bis(2-chloroethyl) sulfide	increases expression	EXP		6480464	Mustard Gas results in increased expression of FOXD4 mRNA	CTD	PMID:15674843
Foxd4	Mouse	bisphenol A	affects methylation	EXP		6480464	bisphenol A affects the methylation of FOXD4 promoter	CTD	PMID:27334623
Foxd4	Mouse	bisphenol A	decreases expression	ISO	Foxd4 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of FOXD4L1 mRNA	CTD	PMID:25181051
Foxd4	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FOXD4 mRNA	CTD	PMID:30951980
Foxd4	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of FOXD4 mRNA	CTD	PMID:30951980
Foxd4	Mouse	calcitriol	increases expression	ISO	FOXD4 (Homo sapiens)	6480464	Calcitriol results in increased expression of FOXD4 mRNA	CTD	PMID:21592394
Foxd4	Mouse	calcitriol	multiple interactions	ISO	FOXD4 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of FOXD4 mRNA	CTD	PMID:21592394
Foxd4	Mouse	choline	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FOXD4 gene	CTD	PMID:20938992
Foxd4	Mouse	cisplatin	multiple interactions	ISO	FOXD4 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of FOXD4 mRNA	CTD	PMID:27392435
Foxd4	Mouse	folic acid	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FOXD4 gene	CTD	PMID:20938992
Foxd4	Mouse	genistein	decreases expression	EXP		6480464	Genistein results in decreased expression of FOXD4 mRNA	CTD	PMID:32186404
Foxd4	Mouse	indole-3-methanol	affects expression	ISO	Foxd4 (Rattus norvegicus)	6480464	indole-3-carbinol affects the expression of FOXD4 mRNA	CTD	PMID:21396975
Foxd4	Mouse	indole-3-methanol	multiple interactions	ISO	Foxd4 (Rattus norvegicus)	6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of FOXD4 mRNA	CTD	PMID:22129741
Foxd4	Mouse	L-methionine	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FOXD4 gene	CTD	PMID:20938992
Foxd4	Mouse	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of FOXD4 mRNA	CTD	PMID:22609695
Foxd4	Mouse	methimazole	increases expression	ISO	Foxd4 (Rattus norvegicus)	6480464	Methimazole results in increased expression of FOXD4 mRNA	CTD	PMID:30047161
Foxd4	Mouse	mono(2-ethylhexyl) phthalate	affects expression	EXP		6480464	mono-(2-ethylhexyl)phthalate affects the expression of FOXD4 mRNA	CTD	PMID:21195148
Foxd4	Mouse	Monobutylphthalate	affects expression	EXP		6480464	monobutyl phthalate affects the expression of FOXD4 mRNA	CTD	PMID:21195148
Foxd4	Mouse	N-acetyl-L-cysteine	multiple interactions	ISO	Foxd4 (Rattus norvegicus)	6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of FOXD4 mRNA	CTD	PMID:22129741
Foxd4	Mouse	N-nitrosodiethylamine	multiple interactions	ISO	Foxd4 (Rattus norvegicus)	6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of FOXD4 mRNA	CTD	PMID:22129741
Foxd4	Mouse	rotenone	decreases expression	ISO	FOXD4 (Homo sapiens)	6480464	Rotenone results in decreased expression of FOXD4 mRNA	CTD	PMID:29955902
Foxd4	Mouse	sotorasib	multiple interactions	ISO	FOXD4 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of FOXD4 mRNA	CTD	PMID:36139627
Foxd4	Mouse	sulfadimethoxine	increases expression	ISO	Foxd4 (Rattus norvegicus)	6480464	Sulfadimethoxine results in increased expression of FOXD4 mRNA	CTD	PMID:30047161
Foxd4	Mouse	testosterone	multiple interactions	ISO	FOXD4 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of FOXD4 mRNA	CTD	PMID:21592394
Foxd4	Mouse	testosterone	increases expression	ISO	FOXD4 (Homo sapiens)	6480464	Testosterone results in increased expression of FOXD4 mRNA	CTD	PMID:21592394
Foxd4	Mouse	Theaflavin 3,3'-digallate	affects expression	ISO	FOXD4 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of FOXD4 mRNA	CTD	PMID:34925699
Foxd4	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of FOXD4 enhancer and titanium dioxide results in decreased methylation of FOXD4 gene	CTD	PMID:35295148
Foxd4	Mouse	trametinib	multiple interactions	ISO	FOXD4 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of FOXD4 mRNA	CTD	PMID:36139627
Foxd4	Mouse	triptonide	increases expression	EXP		6480464	triptonide results in increased expression of FOXD4 mRNA	CTD	PMID:33045310
Foxd4	Mouse	valproic acid	decreases methylation	ISO	FOXD4 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of FOXD4 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Foxd4	Mouse	anatomical structure morphogenesis	involved_in	IBA	PANTHER:PTN000930906 more ...	2290270		GO_Central	GO_REF:0000033
Foxd4	Mouse	cell differentiation	involved_in	IBA	PANTHER:PTN000930906 more ...	2290270		GO_Central	GO_REF:0000033
Foxd4	Mouse	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR001766 more ...	2290270		InterPro	GO_REF:0000002
Foxd4	Mouse	regulation of transcription by RNA polymerase II	involved_in	IBA	PANTHER:PTN000930906 more ...	2290270		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Foxd4	Mouse	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	2290270		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Foxd4	Mouse	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR001766 more ...	2290270		InterPro	GO_REF:0000002
Foxd4	Mouse	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	PANTHER:PTN000930906 more ...	2290270		GO_Central	GO_REF:0000033
Foxd4	Mouse	protein binding	enables	ISO	UniProtKB:P59991 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Foxd4	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	PANTHER:PTN000930906 more ...	2290270		GO_Central	GO_REF:0000033
Foxd4	Mouse	sequence-specific DNA binding	enables	IEA	InterPro:IPR001766 more ...	2290270		InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Foxd4	Mouse	abnormal eye morphology		IEA		5509061		MGI
Foxd4	Mouse	anophthalmia		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7689224	PMID:7957066	PMID:8530406	PMID:8861101	PMID:9449667	PMID:9895322	PMID:10208738	PMID:11820816	PMID:12412011	PMID:12477932	PMID:12812790	PMID:15618518
PMID:15857913	PMID:16602821	PMID:16884697	PMID:17389379	PMID:18287559	PMID:18973680	PMID:20932939	PMID:21267068	PMID:21873635	PMID:22045912	PMID:22711520	PMID:22972626
PMID:22988430	PMID:24952961	PMID:27092474	PMID:29992973	PMID:38355793

Foxd4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	24,876,307 - 24,878,380 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	24,876,600 - 24,878,561 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	24,898,943 - 24,901,016 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	24,899,236 - 24,901,197 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	24,973,455 - 24,975,799 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	24,966,062 - 24,968,406 (-)	NCBI		MGSCv36	mm8
Celera	19	25,674,165 - 25,676,509 (-)	NCBI		Celera
Cytogenetic Map	19	B	NCBI
cM Map	19	19.86	NCBI

FOXD4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	116,231 - 118,417 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	116,231 - 118,417 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	116,231 - 118,417 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	106,234 - 108,419 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	106,055 - 108,204	NCBI
Cytogenetic Map	9	p24.3	NCBI
HuRef	9	58,001 - 60,188 (-)	NCBI		HuRef
CHM1_1	9	116,562 - 118,749 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	110,353 - 112,540 (-)	NCBI		T2T-CHM13v2.0

Foxd4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	231,983,872 - 231,985,565 (-)	NCBI		GRCr8
mRatBN7.2	1	222,557,494 - 222,559,189 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	222,557,360 - 222,559,159 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	242,808,886 - 242,810,186 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	242,808,965 - 242,810,186 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	250,082,104 - 250,083,404 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	228,348,202 - 228,349,654 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	228,512,922 - 228,513,225 (-)	NCBI
Celera	1	219,761,312 - 219,762,612 (-)	NCBI		Celera
Cytogenetic Map	1	q51	NCBI

Foxd4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955434	4,723,198 - 4,725,013 (-)	NCBI	ChiLan1.0	ChiLan1.0

FOXD4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	124,531,633 - 124,558,349 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	124,538,385 - 124,560,226 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	129,258,299 - 129,277,210 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

Foxd4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	136,512,355 - 136,514,796 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936503	4,658,802 - 4,660,203 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXD4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	221,577,685 - 221,580,452 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	247,834,116 - 247,835,450 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Foxd4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624736	4,872,270 - 4,874,153 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Foxd4
55 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	147
Count of miRNA genes:	134
Interacting mature miRNAs:	143
Transcripts:	ENSMUST00000058600
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301271	Datd_m	dopamine transporter density (mouse)			Not determined		19	1	32340234	Mouse
4141659	Pbwg20_m	postnatal body weight growth 20 (mouse)			Not determined		19	21378705	55378928	Mouse
10412251	Mnp_m	modifier of Niemann Pick type C1 (mouse)			Not determined		19	20234314	54234461	Mouse
10413881	Moe2_m	modifier of epilepsy 2 (mouse)					19	14923016	48923138	Mouse
1302004	Lfp2_m	long free running period 2 (mouse)			Not determined		19	18295162	52295381	Mouse
1300923	Bits4_m	bitterness sensitivity 4 (mouse)			Not determined		19	3323216	37323348	Mouse
1357596	Tgct3_m	testicular germ cell tumor 3 (mouse)			Not determined		19	21984091	32912719	Mouse
11039522	Tbbr4_m	Trypanosoma brucei brucei response 4 (mouse)					19	5313326	39313470	Mouse
1301336	Alcp23_m	alcohol preference locus 23 (mouse)			Not determined		19	15912607	49912719	Mouse
1558876	W3q14_m	weight 3 weeks QTL 14 (mouse)			Not determined		19	22313326	53911504	Mouse
1302019	Pgia23_m	proteoglycan induced arthritis 23 (mouse)			Not determined		19	9787453	43787602	Mouse
1301633	Alcp24_m	alcohol preference locus 24 (mouse)			Not determined		19	15912607	49912719	Mouse
14928311	Manh85_m	mandible shape 85 (mouse)					19	11914789	45914789	Mouse
4142343	Moen2_m	modifier of engrailed QTL 2 (mouse)			Not determined		19	20234314	54234461	Mouse
4142406	Pbctlp1_m	peripheral blood cytotoxic T lymphocyte percentage 1 (mouse)			Not determined			1	32875174	Mouse
1300904	Chab5_m	cholesterol absorption 5 (mouse)			Not determined		19	1653764	35653927	Mouse
26884385	Skwq14_m	skull length QTL 14, 16 week (mouse)					19	3250000	35877400	Mouse
1301800	Faq10_m	fluctuating asymmetry QTL 10 (mouse)			Not determined		19	3323216	37323348	Mouse
12801464	Rta2_m	retinal aging 2 (mouse)					14	12302874	25302874	Mouse
1300591	Pas3_m	pulmonary adenoma susceptibility 3 (mouse)			Not determined		19	3323216	37323348	Mouse
1302063	Eae19_m	experimental allergic encephalomyelitis 19 (mouse)			Not determined		19	18295162	52295381	Mouse
1302126	Skull26_m	skull morphology 26 (mouse)			Not determined		19	3323216	37323348	Mouse
1301197	Tlyr1_m	thymic lymphoma resistance 1 (mouse)			Not determined		19	20539528	25313796	Mouse
1301228	Iba4_m	induction of brown adipocytes 4 (mouse)			Not determined		19	9305715	43305821	Mouse

X86368

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	19	24,899,133 - 24,899,331	UniSTS	GRCm38
MGSCv37	19	24,973,623 - 24,973,821	UniSTS	GRCm37
Celera	19	25,674,333 - 25,674,531	UniSTS
Cytogenetic Map	19	B	UniSTS
cM Map	19	17.5	UniSTS
Whitehead/MRC_RH	19	259.68	UniSTS

RH139093

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	19	24,900,485 - 24,900,693	UniSTS	GRCm38
MGSCv37	19	24,974,975 - 24,975,183	UniSTS	GRCm37
Celera	19	25,675,685 - 25,675,893	UniSTS
Cytogenetic Map	19	B	UniSTS
cM Map	19	17.5	UniSTS

Foxd4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	19	24,901,109 - 24,901,895	UniSTS	GRCm38
MGSCv37	19	24,975,599 - 24,976,385	UniSTS	GRCm37
Celera	19	25,676,309 - 25,677,094	UniSTS
Cytogenetic Map	8	E1	UniSTS
Cytogenetic Map	19	B	UniSTS
cM Map	8	65.5	UniSTS
cM Map	19	17.5	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_008022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC138432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC138434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X71940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X86368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000058600 ⟹ ENSMUSP00000058575

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	19	24,876,600 - 24,878,561 (-)	Ensembl
GRCm38.p6 Ensembl	19	24,899,236 - 24,901,197 (-)	Ensembl

RefSeq Acc Id:

NM_008022 ⟹ NP_032048

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	19	24,876,307 - 24,878,380 (-)	NCBI
GRCm38	19	24,898,943 - 24,901,016 (-)	NCBI
MGSCv37	19	24,973,455 - 24,975,799 (-)	RGD
Celera	19	25,674,165 - 25,676,509 (-)	RGD
cM Map	19		ENTREZGENE

Sequence:

show sequence

TTAAAACACCAAGTGCTCCTTGCCAAAGGGTGTTAGAAAGAAAAAGCAGAAAAGAACAAGGAAGCCTAACCTAGGAGCGCTCCAGTTTCCCAGCAGACTCATCCTTGCTAACTCACCCATCCCAAACC
AGGTGAGCTGCCCCCACGTCCGTCCCCTCCTCTCCCTCTTCCCTCCTATCCTCCATGAACTCAGCAAGAGCTGGGCACCTTCGTTCCACTCCACCGCCCAGTCCTCTAAGTTCCGACCAGGATGAGGT
GGAGATCGACGTGCTGGCAGAGGAGGAAGATGGAGATCAGACGGAAGAAGAGGATGACGAGGAGGAGAGCCATAAGTGCCTGGAGCGATCCCTGCAGAGGCCCGGAGCCCGCACTCTTGCAGGGAGGA
GCGCGGGGGACTGCGGCGATCTGAGTAACTCCTCCGGGTTCCTCCGCAAGTTCCGAGCACCACGGACCCCGGCGACCACCACAGCCGACGGCCCGCAGCCCGCCAAACCCCCGTACTCCTACATCGCG
CTCATCACCATGGCCATCCTGCAGAGCCCGCACAAGCGCCTGACGCTCAGCGGTATCTGCGCCTTCATCAGCGGCCGCTTCCCCTATTACCGCCGTAAGTTCCCCGCCTGGCAGAACAGCATCCGCCA
CAACCTGTCGCTCAACGACTGCTTCGTCAAGATCCCTCGCGAGCCGGGCCACCCGGGCAAGGGCAACTATTGGAGCCTGGACCCCGCCTCCCAGGACATGTTCGACAACGGCAGCTTCCTCCGGCGCA
GGAAGCGCTTCAAGCGCCACCACCCGCCCTCGGGAGGCCACCCGCACTGCCCTTTCCCTCCACCCGCTGTGCCCGCCACCCTGCACGTCTCCCAGCCCAGCCTCCTGCTCCGCTACTCTGCCCCACCA
CAGCCTAACCTCGCAGCTCATCCCGCTGCCCCGCCTCGGAGTCACCCGTGCGCCCCGCTGCATCCGCATCCCATGCGCTACCTGCTGCTCGCGGCCCCGGCCTATGGCGACAACCCTAGAAAAGCGGA
AGGCGCGGACCCCGCCACCCCCTTAGCCATTCCCGCGCTGCAGCCCGTACTGGGTTCCCAGCCTTGGGAGAGAGACCAGAGCTCTGGAACTCGGTCCGGACGCGGGTGCGCTTCGTTCACCATCGAGA
GCATCATGCAGGGGGTTACAGGAGGAGGAACTGGGTCTGCGCAGAGTCCGTCCTTTGCTCCGTGGAGCTACTGCCACCTGCTGCAACATCCACCGTGCCTGCTGCACCCCCAGGCCGCTTCCCCTTTG
TTTCACATGTCCGCAGGTTCCCGGACAATATTGCCTCAGCAGCCGCAACCGCCGCTGCCGCTGCAGCAAGAACAGCATCACTGTGCCATTAGCTGCGCTCCCGGTAAAGGCGTGCGGTTAGGCCAGCA
CCTGTCCGCCGTTGCGGCGCTGCTGAGGCAACAGCCTGCAGCTGACGACGGTAGGCTGACAACCCTGGCCGCTCTTTCGGGCCGAGAGGGGACCTTGCCCGAATTTTAAGCAGCACCCAGGCCCAGCC
TCCAGGCTGGGTCGCCTTGGCACACCTGGAGCCAAGTGGCAAAATGGAACCACTTTCTAGGTTTGCACCACCCGCCTGCTAGGCTTGTGCGTAGAAAGCCAGCAGCGGAGTGCGCACTAAGTCCTTCC
AAATTGTTACAAATGTGTTCTGCTCGCTTGACAACACAAAAGTGGGAAAATCCTGGATCTACAAGTCTTGCTTGGTCTTGTCCGCTTCGGTTGTGGCTTCCACGGTTTTCCCGACTTACATACTTCCC
GAGGACCTATGACTATGAAAGTGAGTGAGGTGTTTTGCTGTTAATAAAAACAAAACAGTCTGCAATACAAAACATCACCATCCACATTGCTTAGGAACTGCCAGTGTTCCCAGTGGCGACTGCGACTG
CGAATGCGTACATGCTCCGAAACCCGTAGGTAATACAAATAGGGTAATTTCATAACATTTATCTCTTGTATATACGACGTGTCCTACTCCAACGGGGAGTGTTAAAACTAAGCCTAGTTATAGAGATT
GAATAAAATACGAAACTACAATGCTA

hide sequence


Protein RefSeqs	NP_032048	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI38433	(Get FASTA)	NCBI Sequence Viewer
	AAI38435	(Get FASTA)	NCBI Sequence Viewer
	CAA50742	(Get FASTA)	NCBI Sequence Viewer
	CAA60128	(Get FASTA)	NCBI Sequence Viewer
	EDL41622	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000058575
	ENSMUSP00000058575.3
GenBank Protein	Q60688	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_032048 ⟸ NM_008022

- UniProtKB:

B2RRJ0 (UniProtKB/Swiss-Prot), Q61573 (UniProtKB/Swiss-Prot), Q60688 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MNSARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHKCLERSLQRPGARTLAGRSAGDCGDLSNSSGFLRKFRAPRTPATTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSG
ICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPSGGHPHCPFPPPAVPATLHVSQPSLLLRYSAPPQPNLAAHPAAPPRSHPCA
PLHPHPMRYLLLAAPAYGDNPRKAEGADPATPLAIPALQPVLGSQPWERDQSSGTRSGRGCASFTIESIMQGVTGGGTGSAQSPSFAPWSYCHLLQHPPCLLHPQAASPLFHMSAGSRTILPQQPQPP
LPLQQEQHHCAISCAPGKGVRLGQHLSAVAALLRQQPAADDGRLTTLAALSGREGTLPEF

hide sequence

Ensembl Acc Id:

ENSMUSP00000058575 ⟸ ENSMUST00000058600

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q60688-F1-model_v2	AlphaFold	Q60688	1-444	view protein structure

RGD ID:

6830042

Promoter ID:

MM_KWN:26708

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Kidney, Lung

Transcripts:

NM_008022

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	19	24,973,734 - 24,974,234 (-)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000051490	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000058600	ENTREZGENE
	ENSMUST00000058600.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Fork_head_dom	UniProtKB/Swiss-Prot
	FOX_domain-containing	UniProtKB/Swiss-Prot
	TF_fork_head_CS_1	UniProtKB/Swiss-Prot
	TF_fork_head_CS_2	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:14237	UniProtKB/Swiss-Prot
MGD	MGI:1347467	ENTREZGENE
NCBI Gene	14237	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/Swiss-Prot
	FORKHEAD BOX PROTEIN D4-LIKE 1	UniProtKB/Swiss-Prot
Pfam	Forkhead	UniProtKB/Swiss-Prot
PhenoGen	Foxd4	PhenoGen
PRINTS	FORKHEAD	UniProtKB/Swiss-Prot
PROSITE	FORK_HEAD_1	UniProtKB/Swiss-Prot
	FORK_HEAD_2	UniProtKB/Swiss-Prot
	FORK_HEAD_3	UniProtKB/Swiss-Prot
SMART	SM00339	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	B2RRJ0	ENTREZGENE
	FOXD4_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q61573	ENTREZGENE
UniProt Secondary	B2RRJ0	UniProtKB/Swiss-Prot
	Q61573	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype