Symbol:
TMEM97
Name:
transmembrane protein 97
RGD ID:
1607046
HGNC Page
HGNC:28106
Description:
Predicted to enable cholesterol binding activity and oxysterol binding activity. Involved in several processes, including cholesterol homeostasis; positive regulation of lipoprotein transport; and regulation of intracellular cholesterol transport. Located in several cellular components, including lysosome; nuclear membrane; and rough endoplasmic reticulum. Is active in endoplasmic reticulum.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MAC30; meningioma-associated protein 30; S2R; sigma intracellular receptor 2; sigma-2 receptor; sigma2 receptor; sigma2R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Tmem97 (transmembrane protein 97) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tmem97 (transmembrane protein 97) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Tmem97 (transmembrane protein 97) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
TMEM97 (transmembrane protein 97) NCBI
Ortholog
Canis lupus familiaris (dog):
TMEM97 (transmembrane protein 97) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tmem97 (transmembrane protein 97) NCBI
Ortholog
Sus scrofa (pig):
TMEM97 (transmembrane protein 97) HGNC
Ensembl, NCBI
Chlorocebus sabaeus (green monkey):
TMEM97 (transmembrane protein 97) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Tmem97 (transmembrane protein 97) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Nlk (nemo like kinase) HGNC
Inparanoid, PhylomeDB, Treefam
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tmem97 (transmembrane protein 97)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tmem97 (transmembrane protein 97)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tmem97 (transmembrane protein 97)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
YLR050C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tmem97
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
TMEM97P1
TMEM97P2
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 28,319,200 - 28,328,685 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 28,319,200 - 28,328,685 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 26,646,226 - 26,655,711 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 23,670,248 - 23,679,838 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 23,507,857 - 23,517,453 (+) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 22,854,509 - 22,864,105 (+) NCBI HuRef CHM1_1 17 26,709,006 - 26,718,604 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 29,261,048 - 29,270,533 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
TMEM97 Human (-)-alpha-phellandrene decreases expression EXP 6480464 alpha phellandrene results in decreased expression of TMEM97 mRNA CTD PMID:25075043 TMEM97 Human (-)-epigallocatechin 3-gallate increases expression EXP 6480464 epigallocatechin gallate results in increased expression of TMEM97 mRNA CTD PMID:32512070 TMEM97 Human (1->4)-beta-D-glucan multiple interactions ISO RGD:1316612 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TMEM97 mRNA CTD PMID:36331819 TMEM97 Human (S)-nicotine increases expression ISO RGD:1316612 6480464 Nicotine results in increased expression of TMEM97 mRNA CTD PMID:17997037 TMEM97 Human 1,2-dichloroethane decreases expression ISO RGD:1316612 6480464 ethylene dichloride results in decreased expression of TMEM97 mRNA CTD PMID:28189721|PMID:28960355 TMEM97 Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1316612 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM97 mRNA CTD PMID:22206623 TMEM97 Human 1-naphthyl isothiocyanate increases expression ISO RGD:1307423 6480464 1-Naphthylisothiocyanate results in increased expression of TMEM97 mRNA CTD PMID:30723492 TMEM97 Human 17alpha-ethynylestradiol affects expression ISO RGD:1307423 6480464 Ethinyl Estradiol affects the expression of TMEM97 mRNA CTD PMID:17351261 TMEM97 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TMEM97 mRNA CTD PMID:16474171|PMID:19167446 TMEM97 Human 17beta-estradiol increases expression ISO RGD:1316612 6480464 Estradiol results in increased expression of TMEM97 mRNA CTD PMID:39298647 TMEM97 Human 17beta-estradiol affects expression ISO RGD:1307423 6480464 Estradiol affects the expression of TMEM97 mRNA CTD PMID:32145629 TMEM97 Human 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1316612 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of TMEM97 mRNA CTD PMID:31388691 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1316612 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEM97 mRNA CTD PMID:19933214 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1307423 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEM97 mRNA CTD PMID:34747641 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1307423 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEM97 mRNA CTD PMID:32109520 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEM97 mRNA CTD PMID:20106945|PMID:21632981|PMID:26238291 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TMEM97 mRNA CTD PMID:22574217 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1316612 6480464 Tetrachlorodibenzodioxin affects the expression of TMEM97 mRNA CTD PMID:21570461 TMEM97 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1316612 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEM97 mRNA CTD PMID:20159946 TMEM97 Human 2,4,6-trinitrotoluene affects expression ISO RGD:1307423 6480464 Trinitrotoluene affects the expression of TMEM97 mRNA CTD PMID:21346803 TMEM97 Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of TMEM97 mRNA CTD PMID:30851411 TMEM97 Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of TMEM97 mRNA CTD PMID:37199045 TMEM97 Human 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:1307423 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of TMEM97 mRNA CTD PMID:23196670 TMEM97 Human 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1316612 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of TMEM97 mRNA CTD PMID:26251327 TMEM97 Human 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1307423 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of TMEM97 mRNA CTD PMID:30071829 TMEM97 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 TMEM97 Human 3-methylcholanthrene multiple interactions EXP 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to TMEM97 promoter] CTD PMID:20348232 TMEM97 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 TMEM97 Human 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of TMEM97 gene CTD PMID:31601247 TMEM97 Human 4-amino-2,6-dinitrotoluene affects expression ISO RGD:1307423 6480464 4-amino-2,6-dinitrotoluene affects the expression of TMEM97 mRNA CTD PMID:21346803 TMEM97 Human 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression ISO RGD:1307423 6480464 Omeprazole affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human 6-propyl-2-thiouracil affects expression ISO RGD:1307423 6480464 Propylthiouracil affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human 6-propyl-2-thiouracil increases expression ISO RGD:1307423 6480464 Propylthiouracil results in increased expression of TMEM97 mRNA CTD PMID:30047161 TMEM97 Human aflatoxin B1 decreases expression ISO RGD:1316612 6480464 Aflatoxin B1 results in decreased expression of TMEM97 mRNA CTD PMID:19770486 TMEM97 Human aflatoxin B1 increases expression ISO RGD:1307423 6480464 Aflatoxin B1 results in increased expression of TMEM97 mRNA CTD PMID:33354967 TMEM97 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of TMEM97 intron CTD PMID:30157460 TMEM97 Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of TMEM97 mRNA CTD PMID:27153756 TMEM97 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of TMEM97 mRNA CTD PMID:23724009|PMID:33167477 TMEM97 Human alpha-phellandrene decreases expression EXP 6480464 alpha phellandrene results in decreased expression of TMEM97 mRNA CTD PMID:25075043 TMEM97 Human amiodarone affects expression ISO RGD:1307423 6480464 Amiodarone affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human amitrole increases expression ISO RGD:1307423 6480464 Amitrole results in increased expression of TMEM97 mRNA CTD PMID:30047161 TMEM97 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of TMEM97 mRNA CTD PMID:33212167 TMEM97 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of TMEM97 mRNA CTD PMID:20458559 TMEM97 Human atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TMEM97 mRNA CTD PMID:22378314 TMEM97 Human avobenzone increases expression EXP 6480464 avobenzone results in increased expression of TMEM97 mRNA CTD PMID:31016361 TMEM97 Human azoxystrobin increases expression EXP 6480464 azoxystrobin results in increased expression of TMEM97 mRNA CTD PMID:33512557 TMEM97 Human benzbromarone affects expression ISO RGD:1307423 6480464 Benzbromarone affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TMEM97 mRNA CTD PMID:20064835 TMEM97 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of TMEM97 promoter CTD PMID:27901495 TMEM97 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TMEM97 mRNA CTD PMID:20018196 TMEM97 Human bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of TMEM97 mRNA CTD PMID:25102026 TMEM97 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TMEM97 mRNA CTD PMID:16474171 TMEM97 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TMEM97 gene CTD PMID:31601247 TMEM97 Human bisphenol A decreases expression ISO RGD:1307423 6480464 bisphenol A results in decreased expression of TMEM97 mRNA CTD PMID:34947998 TMEM97 Human bisphenol A decreases expression EXP 6480464 bisphenol A analog results in decreased expression of TMEM97 mRNA CTD PMID:32387340 TMEM97 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TMEM97 mRNA CTD PMID:30903817 TMEM97 Human bisphenol A affects expression ISO RGD:1307423 6480464 bisphenol A affects the expression of TMEM97 mRNA CTD PMID:25181051|PMID:32145629 TMEM97 Human buspirone decreases expression ISO RGD:1307423 6480464 Buspirone results in decreased expression of TMEM97 mRNA CTD PMID:24136188 TMEM97 Human cadmium sulfate multiple interactions EXP 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 TMEM97 Human caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of TMEM97 mRNA CTD PMID:11793227 TMEM97 Human chlorpyrifos increases expression ISO RGD:1316612 6480464 Chlorpyrifos results in increased expression of TMEM97 mRNA CTD PMID:37019170 TMEM97 Human cholesterol affects metabolic processing EXP 6480464 TMEM97 protein affects the metabolism of Cholesterol CTD PMID:18070364 TMEM97 Human clobetasol increases expression ISO RGD:1316612 6480464 Clobetasol results in increased expression of TMEM97 mRNA CTD PMID:27462272 TMEM97 Human clofibrate affects expression ISO RGD:1307423 6480464 Clofibrate affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human clofibrate decreases expression ISO RGD:1316612 6480464 Clofibrate results in decreased expression of TMEM97 mRNA CTD PMID:23811191 TMEM97 Human clotrimazole increases expression ISO RGD:1307423 6480464 Clotrimazole results in increased expression of TMEM97 mRNA CTD PMID:30047161 TMEM97 Human cobalt dichloride multiple interactions EXP 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 TMEM97 Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of TMEM97 mRNA CTD PMID:20971185 TMEM97 Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of TMEM97 mRNA CTD PMID:20971185 TMEM97 Human copper(II) chloride decreases expression EXP 6480464 cupric chloride results in decreased expression of TMEM97 mRNA CTD PMID:34921933 TMEM97 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of TMEM97 mRNA; [Coumestrol co-treated with resveratrol] more ... CTD PMID:19167446 TMEM97 Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of TMEM97 mRNA CTD PMID:19167446 TMEM97 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of TMEM97 mRNA CTD PMID:20106945 TMEM97 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 TMEM97 Human diallyl trisulfide decreases expression EXP 6480464 diallyl trisulfide results in decreased expression of TMEM97 mRNA CTD PMID:34995734 TMEM97 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of TMEM97 mRNA CTD PMID:20458559 TMEM97 Human dibenzofurans increases expression ISO RGD:1316612 6480464 Dibenzofurans results in increased expression of TMEM97 mRNA CTD PMID:34254344 TMEM97 Human dibutyl phthalate decreases expression ISO RGD:1307423 6480464 Dibutyl Phthalate results in decreased expression of TMEM97 mRNA CTD PMID:21266533 TMEM97 Human dibutyl phthalate decreases expression ISO RGD:1316612 6480464 Dibutyl Phthalate results in decreased expression of TMEM97 mRNA CTD PMID:17361019 TMEM97 Human dopamine increases expression ISO RGD:1307423 6480464 Dopamine results in increased expression of TMEM97 mRNA CTD PMID:21983523 TMEM97 Human doxorubicin affects response to substance EXP 6480464 TMEM97 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 TMEM97 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of TMEM97 mRNA CTD PMID:29803840 TMEM97 Human endosulfan decreases expression ISO RGD:1307423 6480464 Endosulfan results in decreased expression of TMEM97 mRNA CTD PMID:29391264 TMEM97 Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of TMEM97 mRNA CTD PMID:19167446 TMEM97 Human epoxiconazole decreases expression ISO RGD:1316612 6480464 epoxiconazole results in decreased expression of TMEM97 mRNA CTD PMID:35436446 TMEM97 Human ethanol affects expression ISO RGD:1316612 6480464 Ethanol affects the expression of TMEM97 mRNA CTD PMID:30319688 TMEM97 Human ethyl methanesulfonate decreases expression EXP 6480464 Ethyl Methanesulfonate results in decreased expression of TMEM97 mRNA CTD PMID:23649840 TMEM97 Human etoposide affects response to substance EXP 6480464 TMEM97 protein affects the susceptibility to Etoposide CTD PMID:16217747 TMEM97 Human fenoldopam increases expression ISO RGD:1307423 6480464 Fenoldopam results in increased expression of TMEM97 mRNA CTD PMID:21983523 TMEM97 Human finasteride increases expression ISO RGD:1307423 6480464 Finasteride results in increased expression of TMEM97 mRNA CTD PMID:24136188 TMEM97 Human fluoranthene multiple interactions ISO RGD:1316612 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of TMEM97 mRNA CTD PMID:28329830 TMEM97 Human flutamide increases expression ISO RGD:1307423 6480464 Flutamide results in increased expression of TMEM97 mRNA CTD PMID:24136188 TMEM97 Human folic acid multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of TMEM97 mRNA CTD PMID:24657277 TMEM97 Human folic acid multiple interactions ISO RGD:1316612 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM97 mRNA CTD PMID:22206623 TMEM97 Human folpet decreases expression ISO RGD:1316612 6480464 folpet results in decreased expression of TMEM97 mRNA CTD PMID:31558096 TMEM97 Human formaldehyde decreases expression EXP 6480464 Formaldehyde results in decreased expression of TMEM97 mRNA CTD PMID:23649840 TMEM97 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TMEM97 gene CTD PMID:31601247 TMEM97 Human genistein increases expression EXP 6480464 Genistein results in increased expression of TMEM97 mRNA CTD PMID:16474171 TMEM97 Human gentamycin decreases expression ISO RGD:1307423 6480464 Gentamicins results in decreased expression of TMEM97 mRNA CTD PMID:33387578 TMEM97 Human glafenine increases expression ISO RGD:1307423 6480464 Glafenine results in increased expression of TMEM97 mRNA CTD PMID:24136188 TMEM97 Human GSK-J4 decreases expression EXP 6480464 GSK-J4 results in decreased expression of TMEM97 mRNA CTD PMID:29301935 TMEM97 Human hydroquinone decreases expression EXP 6480464 hydroquinone results in decreased expression of TMEM97 mRNA CTD PMID:31256213 TMEM97 Human indole-3-methanol affects expression ISO RGD:1307423 6480464 indole-3-carbinol affects the expression of TMEM97 mRNA CTD PMID:21396975 TMEM97 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 TMEM97 Human inulin multiple interactions ISO RGD:1316612 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TMEM97 mRNA CTD PMID:36331819 TMEM97 Human isotretinoin decreases expression EXP 6480464 Isotretinoin results in decreased expression of TMEM97 mRNA CTD PMID:20436886 TMEM97 Human L-ethionine affects expression ISO RGD:1307423 6480464 Ethionine affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human lead(II) chloride multiple interactions EXP 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 TMEM97 Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of TMEM97 mRNA CTD PMID:28988120 TMEM97 Human methimazole increases expression ISO RGD:1307423 6480464 Methimazole results in increased expression of TMEM97 mRNA CTD PMID:30047161 TMEM97 Human methotrexate multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of TMEM97 mRNA CTD PMID:24657277 TMEM97 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of TMEM97 mRNA CTD PMID:23649840 TMEM97 Human miconazole increases expression ISO RGD:1316612 6480464 Miconazole results in increased expression of TMEM97 mRNA CTD PMID:27462272 TMEM97 Human mitomycin C affects response to substance EXP 6480464 TMEM97 protein affects the susceptibility to Mitomycin CTD PMID:16217747 TMEM97 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of TMEM97 mRNA CTD PMID:24768652|PMID:25583101 TMEM97 Human nicotine increases expression ISO RGD:1316612 6480464 Nicotine results in increased expression of TMEM97 mRNA CTD PMID:17997037 TMEM97 Human nimesulide increases expression ISO RGD:1307423 6480464 nimesulide results in increased expression of TMEM97 mRNA CTD PMID:24136188 TMEM97 Human okadaic acid decreases expression EXP 6480464 Okadaic Acid results in decreased expression of TMEM97 mRNA CTD PMID:38832940 TMEM97 Human omeprazole affects expression ISO RGD:1307423 6480464 Omeprazole affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TMEM97 mRNA CTD PMID:11793227|PMID:29067470 TMEM97 Human paracetamol affects expression ISO RGD:1316612 6480464 Acetaminophen affects the expression of TMEM97 mRNA CTD PMID:17562736 TMEM97 Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1316612 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TMEM97 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 TMEM97 Human perfluorooctanoic acid increases expression ISO RGD:1307423 6480464 perfluorooctanoic acid results in increased expression of TMEM97 mRNA CTD PMID:35163327 TMEM97 Human phenethyl isothiocyanate decreases expression EXP 6480464 phenethyl isothiocyanate results in decreased expression of TMEM97 mRNA CTD PMID:26678675 TMEM97 Human phenobarbital increases expression ISO RGD:1316612 6480464 Phenobarbital results in increased expression of TMEM97 mRNA CTD PMID:19482888 TMEM97 Human phenobarbital multiple interactions ISO RGD:1316612 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TMEM97 mRNA] CTD PMID:19482888 TMEM97 Human pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 TMEM97 Human pirinixic acid affects expression ISO RGD:1307423 6480464 pirinixic acid affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of TMEM97 mRNA CTD PMID:18070364 TMEM97 Human pyrimidifen increases expression EXP 6480464 pyrimidifen results in increased expression of TMEM97 mRNA CTD PMID:33512557 TMEM97 Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of TMEM97 mRNA CTD PMID:30851411 TMEM97 Human resveratrol multiple interactions EXP 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of TMEM97 mRNA CTD PMID:19167446 TMEM97 Human rotenone increases expression ISO RGD:1307423 6480464 Rotenone results in increased expression of TMEM97 mRNA CTD PMID:19013527 TMEM97 Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of TMEM97 mRNA CTD PMID:33512557 TMEM97 Human rotenone affects expression ISO RGD:1307423 6480464 Rotenone affects the expression of TMEM97 mRNA CTD PMID:28374803 TMEM97 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TMEM97 mRNA CTD PMID:28595984|PMID:34032870 TMEM97 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TMEM97 mRNA CTD PMID:38568856 TMEM97 Human sulfadimethoxine increases expression ISO RGD:1307423 6480464 Sulfadimethoxine results in increased expression of TMEM97 mRNA CTD PMID:30047161 TMEM97 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of TMEM97 mRNA CTD PMID:31533062 TMEM97 Human tebuconazole increases expression EXP 6480464 tebuconazole results in increased expression of TMEM97 mRNA CTD PMID:30458266 TMEM97 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of TMEM97 mRNA CTD PMID:33359661 TMEM97 Human testosterone decreases expression ISO RGD:1316612 6480464 Testosterone deficiency results in decreased expression of TMEM97 mRNA CTD PMID:33848595 TMEM97 Human tetrachloroethene increases expression ISO RGD:1316612 6480464 Tetrachloroethylene results in increased expression of TMEM97 mRNA CTD PMID:28973375 TMEM97 Human thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of TMEM97 mRNA CTD PMID:22378314 TMEM97 Human thifluzamide decreases expression EXP 6480464 thifluzamide results in decreased expression of TMEM97 mRNA CTD PMID:33512557 TMEM97 Human thimerosal decreases expression EXP 6480464 Thimerosal results in decreased expression of TMEM97 mRNA CTD PMID:27188386 TMEM97 Human thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TMEM97 mRNA CTD PMID:11793227 TMEM97 Human thioacetamide affects expression ISO RGD:1307423 6480464 Thioacetamide affects the expression of TMEM97 mRNA CTD PMID:19483382 TMEM97 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of TMEM97 mRNA CTD PMID:38568856 TMEM97 Human titanium dioxide increases expression ISO RGD:1316612 6480464 titanium dioxide results in increased expression of TMEM97 mRNA CTD PMID:27760801 TMEM97 Human topotecan affects response to substance EXP 6480464 TMEM97 protein affects the susceptibility to Topotecan CTD PMID:16217747 TMEM97 Human trimellitic anhydride increases expression ISO RGD:1316612 6480464 trimellitic anhydride results in increased expression of TMEM97 mRNA CTD PMID:19042947 TMEM97 Human triphenyl phosphate affects expression ISO RGD:1307423 6480464 triphenyl phosphate affects the expression of TMEM97 mRNA CTD PMID:30589522 TMEM97 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of TMEM97 mRNA CTD PMID:37042841 TMEM97 Human Triptolide decreases expression ISO RGD:1316612 6480464 triptolide results in decreased expression of TMEM97 mRNA CTD PMID:32835833 TMEM97 Human troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of TMEM97 mRNA CTD PMID:19140230 TMEM97 Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of TMEM97 mRNA CTD PMID:22378314 TMEM97 Human urethane decreases expression EXP 6480464 Urethane results in decreased expression of TMEM97 mRNA CTD PMID:28818685 TMEM97 Human valproic acid decreases expression ISO RGD:1316612 6480464 Valproic Acid results in decreased expression of TMEM97 mRNA CTD PMID:21427059 TMEM97 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of TMEM97 mRNA CTD PMID:25979313 TMEM97 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TMEM97 mRNA; Valproic Acid results in decreased expression more ... CTD PMID:23179753|PMID:28001369|PMID:29154799|PMID:29501571 TMEM97 Human vincaleukoblastine affects response to substance EXP 6480464 TMEM97 protein affects the susceptibility to Vinblastine CTD PMID:16217747 TMEM97 Human vinclozolin decreases expression ISO RGD:1307423 6480464 vinclozolin results in decreased expression of TMEM97 mRNA CTD PMID:23034163 TMEM97 Human zidovudine multiple interactions EXP 6480464 [Zidovudine co-treated with IFNA1 protein] results in decreased expression of TMEM97 mRNA CTD PMID:20370541 TMEM97 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of TMEM97 mRNA CTD PMID:24714768
(-)-alpha-phellandrene (EXP) (-)-epigallocatechin 3-gallate (EXP) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (ISO) 2-hydroxypropanoic acid (EXP) 2-palmitoylglycerol (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP) 4-amino-2,6-dinitrotoluene (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) alpha-phellandrene (EXP) amiodarone (ISO) amitrole (ISO) aristolochic acid A (EXP) arsenous acid (EXP) atrazine (EXP) avobenzone (EXP) azoxystrobin (EXP) benzbromarone (ISO) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (EXP) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) buspirone (ISO) cadmium sulfate (EXP) caffeine (EXP) chlorpyrifos (ISO) cholesterol (EXP) clobetasol (ISO) clofibrate (ISO) clotrimazole (ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) copper(II) chloride (EXP) coumestrol (EXP) cyclosporin A (EXP) dexamethasone (EXP) diallyl trisulfide (EXP) diarsenic trioxide (EXP) dibenzofurans (ISO) dibutyl phthalate (ISO) dopamine (ISO) doxorubicin (EXP) endosulfan (ISO) Enterolactone (EXP) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (EXP) etoposide (EXP) fenoldopam (ISO) finasteride (ISO) fluoranthene (ISO) flutamide (ISO) folic acid (EXP,ISO) folpet (ISO) formaldehyde (EXP) fulvestrant (EXP) genistein (EXP) gentamycin (ISO) glafenine (ISO) GSK-J4 (EXP) hydroquinone (EXP) indole-3-methanol (ISO) indometacin (EXP) inulin (ISO) isotretinoin (EXP) L-ethionine (ISO) lead(II) chloride (EXP) leflunomide (EXP) methimazole (ISO) methotrexate (EXP) methyl methanesulfonate (EXP) miconazole (ISO) mitomycin C (EXP) nickel atom (EXP) nicotine (ISO) nimesulide (ISO) okadaic acid (EXP) omeprazole (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl isothiocyanate (EXP) phenobarbital (ISO) pirinixic acid (EXP,ISO) progesterone (EXP) pyrimidifen (EXP) rac-lactic acid (EXP) resveratrol (EXP) rotenone (EXP,ISO) sodium arsenite (EXP) sulfadimethoxine (ISO) sunitinib (EXP) tebuconazole (EXP) testosterone (EXP,ISO) tetrachloroethene (ISO) thapsigargin (EXP) thifluzamide (EXP) thimerosal (EXP) thioacetamide (EXP,ISO) thiram (EXP) titanium dioxide (ISO) topotecan (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) Triptolide (ISO) troglitazone (EXP) tunicamycin (EXP) urethane (EXP) valproic acid (EXP,ISO) vincaleukoblastine (EXP) vinclozolin (ISO) zidovudine (EXP) zoledronic acid (EXP)
TMEM97 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 28,319,200 - 28,328,685 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 28,319,200 - 28,328,685 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 26,646,226 - 26,655,711 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 23,670,248 - 23,679,838 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 23,507,857 - 23,517,453 (+) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 22,854,509 - 22,864,105 (+) NCBI HuRef CHM1_1 17 26,709,006 - 26,718,604 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 29,261,048 - 29,270,533 (+) NCBI T2T-CHM13v2.0
Tmem97 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 78,432,643 - 78,441,561 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 78,432,643 - 78,441,603 (-) Ensembl GRCm39 Ensembl GRCm38 11 78,541,817 - 78,550,735 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 78,541,817 - 78,550,777 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 78,355,319 - 78,364,237 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 78,358,012 - 78,366,930 (-) NCBI MGSCv36 mm8 Celera 11 88,173,890 - 88,182,808 (-) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 46.74 NCBI
Tmem97 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 63,936,276 - 63,945,359 (-) NCBI GRCr8 mRatBN7.2 10 63,438,228 - 63,447,311 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 63,438,222 - 63,589,730 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 68,070,852 - 68,079,944 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 67,576,183 - 67,585,275 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 63,045,738 - 63,054,825 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 65,811,455 - 65,820,538 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 65,811,456 - 65,820,538 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 65,823,082 - 65,832,165 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 64,652,641 - 64,661,724 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 64,666,264 - 64,675,347 (-) NCBI Celera 10 62,414,772 - 62,423,855 (-) NCBI Celera Cytogenetic Map 10 q25 NCBI
Tmem97 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 4,807,850 - 4,817,006 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 4,807,850 - 4,817,006 (-) NCBI ChiLan1.0 ChiLan1.0
TMEM97 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 36,130,408 - 36,140,584 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 38,010,800 - 38,020,975 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 28,446,213 - 28,455,332 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 28,948,225 - 28,957,345 (-) NCBI panpan1.1 PanPan1.1 panPan2
TMEM97 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 42,572,855 - 42,581,012 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 42,572,889 - 42,579,947 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 41,729,777 - 41,737,940 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 43,391,799 - 43,400,150 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 43,391,761 - 43,400,631 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 42,176,287 - 42,184,423 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 42,467,497 - 42,475,646 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 42,544,521 - 42,552,694 (+) NCBI UU_Cfam_GSD_1.0
Tmem97 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 41,597,080 - 41,606,883 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 4,475,256 - 4,484,643 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 4,475,314 - 4,484,385 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMEM97
TMEM97
Tmem97
.
Predicted Target Of
Count of predictions: 2042 Count of miRNA genes: 783 Interacting mature miRNAs: 877 Transcripts: ENST00000226230, ENST00000336687, ENST00000582113, ENST00000582384, ENST00000583381 Prediction methods: Miranda, Pita, Rnahybrid Result types: miRGate_prediction
597091411 GWAS1187485_H atrophic macular degeneration, age-related macular degeneration, wet macular degeneration QTL GWAS1187485 (human) 1e-08 atrophic macular degeneration, age-related macular degeneration, wet macular degeneration 17 28322698 28322699 Human 597122322 GWAS1218396_H blood protein measurement QTL GWAS1218396 (human) 9e-29 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597275326 GWAS1371400_H age-related macular degeneration, COVID-19 QTL GWAS1371400 (human) 3e-09 age-related macular degeneration, COVID-19 17 28322698 28322699 Human 597301363 GWAS1397437_H PAX-interacting protein 1 measurement QTL GWAS1397437 (human) 4e-12 PAX-interacting protein 1 measurement 17 28322698 28322699 Human 597172369 GWAS1268443_H poly(A) RNA polymerase, mitochondrial measurement QTL GWAS1268443 (human) 2e-17 poly(A) RNA polymerase, mitochondrial measurement 17 28322698 28322699 Human 597143518 GWAS1239592_H low density lipoprotein cholesterol measurement QTL GWAS1239592 (human) 5e-09 low density lipoprotein cholesterol measurement blood low density lipoprotein cholesterol level (CMO:0000053) 17 28326181 28326182 Human 597121693 GWAS1217767_H blood protein measurement QTL GWAS1217767 (human) 1e-12 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597123419 GWAS1219493_H blood protein measurement QTL GWAS1219493 (human) 1e-14 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597235540 GWAS1331614_H blood protein measurement QTL GWAS1331614 (human) 3e-31 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597172790 GWAS1268864_H carboxypeptidase Z measurement QTL GWAS1268864 (human) 4e-15 carboxypeptidase Z measurement 17 28322698 28322699 Human 597118439 GWAS1214513_H blood protein measurement QTL GWAS1214513 (human) 2e-14 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 1298406 BP16_H Blood pressure QTL 16 (human) 0.0004 Blood pressure hypertension susceptibility 17 14778647 40778647 Human 597123649 GWAS1219723_H blood protein measurement QTL GWAS1219723 (human) 3e-13 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597275553 GWAS1371627_H age-related macular degeneration, COVID-19 QTL GWAS1371627 (human) 2e-09 age-related macular degeneration, COVID-19 17 28322698 28322699 Human 597123631 GWAS1219705_H blood protein measurement QTL GWAS1219705 (human) 7e-16 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597121486 GWAS1217560_H blood protein measurement QTL GWAS1217560 (human) 2e-28 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597143148 GWAS1239222_H low density lipoprotein cholesterol measurement QTL GWAS1239222 (human) 3e-21 low density lipoprotein cholesterol measurement blood low density lipoprotein cholesterol level (CMO:0000053) 17 28322698 28322699 Human 597122187 GWAS1218261_H blood protein measurement QTL GWAS1218261 (human) 3e-17 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human 597122763 GWAS1218837_H blood protein measurement QTL GWAS1218837 (human) 2e-15 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 28322698 28322699 Human
SHGC-11786
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,655,146 - 26,655,232 UniSTS GRCh37 Build 36 17 23,679,273 - 23,679,359 RGD NCBI36 Celera 17 23,516,888 - 23,516,974 RGD Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 17 q11.2 UniSTS HuRef 8 19,331,779 - 19,331,848 UniSTS GeneMap99-G3 RH Map 17 1526.0 UniSTS
RH17628
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,655,050 - 26,655,209 UniSTS GRCh37 Build 36 17 23,679,177 - 23,679,336 RGD NCBI36 Celera 17 23,516,792 - 23,516,951 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 22,863,444 - 22,863,603 UniSTS
RH24980
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,655,433 - 26,655,644 UniSTS GRCh37 Build 36 17 23,679,560 - 23,679,771 RGD NCBI36 Celera 17 23,517,175 - 23,517,386 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 22,863,827 - 22,864,038 UniSTS
SHGC-132058
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,655,369 - 26,655,687 UniSTS GRCh37 Build 36 17 23,679,496 - 23,679,814 RGD NCBI36 Celera 17 23,517,111 - 23,517,429 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 22,863,763 - 22,864,081 UniSTS TNG Radiation Hybrid Map 17 10748.0 UniSTS
UniSTS:21338
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,655,372 - 26,655,588 UniSTS GRCh37 Build 36 17 23,679,499 - 23,679,715 RGD NCBI36 Celera 17 23,517,114 - 23,517,330 RGD HuRef 17 22,863,766 - 22,863,982 UniSTS
D20S1105
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,655,352 - 26,655,584 UniSTS GRCh37 Build 36 17 23,679,479 - 23,679,711 RGD NCBI36 Celera 17 23,517,094 - 23,517,326 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 22,863,746 - 22,863,978 UniSTS Stanford-G3 RH Map 17 1023.0 UniSTS GeneMap99-G3 RH Map 17 1524.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2249
4969
1726
2351
5
624
1948
465
2268
7297
6463
53
3732
1
850
1740
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000226230 ⟹ ENSP00000226230
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,319,200 - 28,328,685 (+) Ensembl
Ensembl Acc Id:
ENST00000336687 ⟹ ENSP00000466987
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,319,455 - 28,328,225 (+) Ensembl
Ensembl Acc Id:
ENST00000582113 ⟹ ENSP00000462827
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,319,206 - 28,325,835 (+) Ensembl
Ensembl Acc Id:
ENST00000582384 ⟹ ENSP00000462924
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,319,269 - 28,327,511 (+) Ensembl
Ensembl Acc Id:
ENST00000583381 ⟹ ENSP00000466211
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,319,202 - 28,326,875 (+) Ensembl
RefSeq Acc Id:
NM_014573 ⟹ NP_055388
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 28,319,200 - 28,328,685 (+) NCBI GRCh37 17 26,646,121 - 26,655,711 (+) RGD Build 36 17 23,670,248 - 23,679,838 (+) NCBI Archive Celera 17 23,507,857 - 23,517,453 (+) RGD HuRef 17 22,854,509 - 22,864,105 (+) ENTREZGENE CHM1_1 17 26,709,006 - 26,718,604 (+) NCBI T2T-CHM13v2.0 17 29,261,048 - 29,270,533 (+) NCBI
Sequence:
CTCTTCTCACATCAGCGGGTCCAGGCCCAACCGACAGACTATGGGGGCTCCGGCAACCAGGCGCTGCGTGGAGTGGCTGCTGGGCCTCTACTTCCTCAGCCACATCCCCATCACCCTGTTCATGGACC
hide sequence
RefSeq Acc Id:
NP_055388 ⟸ NM_014573
- UniProtKB:
B4DS02 (UniProtKB/Swiss-Prot), Q07823 (UniProtKB/Swiss-Prot), Q5BJF2 (UniProtKB/Swiss-Prot), B4DDT6 (UniProtKB/TrEMBL)
- Sequence:
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASG
hide sequence
Ensembl Acc Id:
ENSP00000462924 ⟸ ENST00000582384
Ensembl Acc Id:
ENSP00000462827 ⟸ ENST00000582113
Ensembl Acc Id:
ENSP00000466211 ⟸ ENST00000583381
Ensembl Acc Id:
ENSP00000466987 ⟸ ENST00000336687
Ensembl Acc Id:
ENSP00000226230 ⟸ ENST00000226230
RGD ID: 6794632 Promoter ID: HG_KWN:25534 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: NM_014573 Position: Human Assembly Chr Position (strand) Source Build 36 17 23,669,851 - 23,670,351 (+) MPROMDB
RGD ID: 7234339 Promoter ID: EPDNEW_H22915 Type: initiation region Name: TMEM97_1 Description: transmembrane protein 97 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 28,319,200 - 28,319,260 EPDNEW
