Advanced Search (OLGA)

Gene: NUP62CL (nucleoporin 62 C-terminal like) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

NUP62CL

Name:

nucleoporin 62 C-terminal like

RGD ID:

1606555

HGNC Page

HGNC:25960

Description:

Predicted to be a structural constituent of nuclear pore. Predicted to be involved in nucleocytoplasmic transport and protein transport. Predicted to be located in nuclear envelope. Predicted to be part of nuclear pore.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

FLJ20130; nucleoporin 62kDa C-terminal like; nucleoporin-62 C-terminal-like protein; RP13-383K5.2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	107,123,427 - 107,206,433 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	107,123,427 - 107,206,433 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	106,366,657 - 106,449,663 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	106,253,358 - 106,336,200 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	X	106,837,965 - 106,921,027 (-)	NCBI		Celera
Cytogenetic Map	X	q22.3	NCBI
HuRef	X	95,994,426 - 96,076,159 (-)	NCBI		HuRef
CHM1_1	X	106,277,530 - 106,360,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	105,559,960 - 105,642,842 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUP62CL	Human	autistic disorder		IAGP	RGD:14351525	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106\|PMID:30208311
NUP62CL	Human	autosomal hemophilia A		IAGP	RGD:408387586	8554872	ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A	ClinVar	PMID:31690835
NUP62CL	Human	Charcot-Marie-Tooth disease type X		IAGP	RGD:156450443	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth Neuropathy X	ClinVar	PMID:24528855\|PMID:28492532
NUP62CL	Human	factor VIII deficiency		IAGP	RGD:408387586	8554872	ClinVar Annotator: match by term: Factor 8 deficiency, congenital	ClinVar	PMID:31690835
NUP62CL	Human	syndromic X-linked intellectual disability Lubs type		IAGP	RGD:14399337	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUP62CL	Human	1,2-dichloroethane	decreases expression	ISO	RGD:1621989	6480464	ethylene dichloride results in decreased expression of NUP62CL mRNA	CTD	PMID:28960355
NUP62CL	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1564353	6480464	Tetrachlorodibenzodioxin results in decreased expression of NUP62CL mRNA	CTD	PMID:22808131
NUP62CL	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1564353	6480464	Tetrachlorodibenzodioxin results in increased expression of NUP62CL mRNA	CTD	PMID:32109520
NUP62CL	Human	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1621989	6480464	bisphenol S results in increased expression of NUP62CL mRNA	CTD	PMID:30951980
NUP62CL	Human	6-propyl-2-thiouracil	multiple interactions	ISO	RGD:1621989	6480464	[Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of NUP62CL mRNA	CTD	PMID:36706583
NUP62CL	Human	aflatoxin B1	affects expression	EXP		6480464	Aflatoxin B1 affects the expression of NUP62CL protein	CTD	PMID:20106945
NUP62CL	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of NUP62CL intron	CTD	PMID:30157460
NUP62CL	Human	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of NUP62CL mRNA	CTD	PMID:21632981
NUP62CL	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of NUP62CL mRNA	CTD	PMID:23724009
NUP62CL	Human	all-trans-retinoic acid	increases expression	ISO	RGD:1621989	6480464	Tretinoin results in increased expression of NUP62CL mRNA	CTD	PMID:36189433
NUP62CL	Human	all-trans-retinoic acid	multiple interactions	ISO	RGD:1621989	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NUP62CL mRNA	CTD	PMID:36189433
NUP62CL	Human	amphetamine	increases expression	ISO	RGD:1564353	6480464	Amphetamine results in increased expression of NUP62CL mRNA	CTD	PMID:30779732
NUP62CL	Human	arsane	increases methylation	EXP		6480464	Arsenic results in increased methylation of NUP62CL promoter	CTD	PMID:21291286
NUP62CL	Human	arsane	multiple interactions	EXP		6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of NUP62CL more ...	CTD	PMID:32525701
NUP62CL	Human	arsenic atom	increases methylation	EXP		6480464	Arsenic results in increased methylation of NUP62CL promoter	CTD	PMID:21291286
NUP62CL	Human	arsenic atom	multiple interactions	EXP		6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of NUP62CL more ...	CTD	PMID:32525701
NUP62CL	Human	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of NUP62CL mRNA	CTD	PMID:21632981\|PMID:32234424
NUP62CL	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of NUP62CL 5' UTR	CTD	PMID:27901495
NUP62CL	Human	beta-lapachone	increases expression	EXP		6480464	beta-lapachone results in increased expression of NUP62CL mRNA	CTD	PMID:38218311
NUP62CL	Human	bisphenol A	affects expression	ISO	RGD:1564353	6480464	bisphenol A affects the expression of NUP62CL mRNA	CTD	PMID:25181051
NUP62CL	Human	bisphenol F	increases expression	ISO	RGD:1621989	6480464	bisphenol F results in increased expression of NUP62CL mRNA	CTD	PMID:38685157
NUP62CL	Human	cadmium atom	decreases expression	EXP		6480464	Cadmium results in decreased expression of NUP62CL mRNA	CTD	PMID:24376830
NUP62CL	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NUP62CL more ...	CTD	PMID:35301059
NUP62CL	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NUP62CL more ...	CTD	PMID:35301059
NUP62CL	Human	calcitriol	increases expression	EXP		6480464	Calcitriol results in increased expression of NUP62CL mRNA	CTD	PMID:16002434
NUP62CL	Human	calcitriol	multiple interactions	EXP		6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of NUP62CL mRNA	CTD	PMID:21592394
NUP62CL	Human	calcitriol	decreases expression	EXP		6480464	Calcitriol results in decreased expression of NUP62CL mRNA	CTD	PMID:21592394
NUP62CL	Human	carbamazepine	affects expression	EXP		6480464	Carbamazepine affects the expression of NUP62CL mRNA	CTD	PMID:25979313
NUP62CL	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in increased expression of NUP62CL mRNA	CTD	PMID:27392435
NUP62CL	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of NUP62CL mRNA	CTD	PMID:27392435
NUP62CL	Human	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of NUP62CL mRNA	CTD	PMID:19376846
NUP62CL	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of NUP62CL mRNA	CTD	PMID:19549813
NUP62CL	Human	coumestrol	increases expression	EXP		6480464	Coumestrol results in increased expression of NUP62CL mRNA	CTD	PMID:19167446
NUP62CL	Human	coumestrol	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of NUP62CL mRNA	CTD	PMID:19167446
NUP62CL	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of NUP62CL mRNA	CTD	PMID:20106945\|PMID:27989131
NUP62CL	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of NUP62CL mRNA	CTD	PMID:25562108
NUP62CL	Human	diiodine	multiple interactions	ISO	RGD:1621989	6480464	[Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of NUP62CL mRNA	CTD	PMID:36706583
NUP62CL	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
NUP62CL	Human	Enterolactone	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of NUP62CL mRNA	CTD	PMID:19167446
NUP62CL	Human	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of NUP62CL mRNA	CTD	PMID:28986285
NUP62CL	Human	methotrexate	increases expression	EXP		6480464	Methotrexate results in increased expression of NUP62CL mRNA	CTD	PMID:24449571
NUP62CL	Human	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1621989	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NUP62CL mRNA	CTD	PMID:36189433
NUP62CL	Human	okadaic acid	increases expression	EXP		6480464	Okadaic Acid results in increased expression of NUP62CL mRNA	CTD	PMID:38832940
NUP62CL	Human	oxaliplatin	multiple interactions	ISO	RGD:1564353	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of NUP62CL mRNA	CTD	PMID:25729387
NUP62CL	Human	p-chloromercuribenzoic acid	decreases expression	EXP		6480464	p-Chloromercuribenzoic Acid results in decreased expression of NUP62CL mRNA	CTD	PMID:26272509
NUP62CL	Human	p-chloromercuribenzoic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
NUP62CL	Human	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of NUP62CL mRNA	CTD	PMID:22230336
NUP62CL	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of NUP62CL mRNA	CTD	PMID:26690555
NUP62CL	Human	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1621989	6480464	perfluorohexanesulfonic acid results in increased expression of NUP62CL mRNA	CTD	PMID:37995155
NUP62CL	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1621989	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of NUP62CL mRNA	CTD	PMID:36331819
NUP62CL	Human	quercetin	increases expression	EXP		6480464	Quercetin results in increased expression of NUP62CL mRNA	CTD	PMID:21632981
NUP62CL	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
NUP62CL	Human	silicon dioxide	decreases expression	EXP		6480464	Silicon Dioxide results in decreased expression of NUP62CL mRNA	CTD	PMID:25351596
NUP62CL	Human	sodium arsenate	multiple interactions	EXP		6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of NUP62CL more ...	CTD	PMID:32525701
NUP62CL	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of NUP62CL mRNA	CTD	PMID:38568856
NUP62CL	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of NUP62CL mRNA	CTD	PMID:31533062
NUP62CL	Human	testosterone	multiple interactions	EXP		6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of NUP62CL mRNA	CTD	PMID:21592394
NUP62CL	Human	testosterone	decreases expression	EXP		6480464	Testosterone results in decreased expression of NUP62CL mRNA	CTD	PMID:21592394
NUP62CL	Human	thalidomide	decreases expression	ISO	RGD:1621989	6480464	Thalidomide results in decreased expression of NUP62CL mRNA	CTD	PMID:26217789
NUP62CL	Human	thiram	decreases expression	EXP		6480464	Thiram results in decreased expression of NUP62CL mRNA	CTD	PMID:38568856
NUP62CL	Human	titanium dioxide	decreases methylation	ISO	RGD:1621989	6480464	titanium dioxide results in decreased methylation of NUP62CL gene	CTD	PMID:35295148
NUP62CL	Human	titanium dioxide	decreases expression	ISO	RGD:1621989	6480464	titanium dioxide results in decreased expression of NUP62CL mRNA	CTD	PMID:35295148
NUP62CL	Human	topotecan	multiple interactions	ISO	RGD:1564353	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of NUP62CL mRNA	CTD	PMID:25729387
NUP62CL	Human	torcetrapib	increases expression	EXP		6480464	torcetrapib results in increased expression of NUP62CL mRNA	CTD	PMID:23228038
NUP62CL	Human	triclosan	decreases expression	EXP		6480464	Triclosan results in decreased expression of NUP62CL mRNA	CTD	PMID:30510588
NUP62CL	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of NUP62CL mRNA	CTD	PMID:25979313
NUP62CL	Human	valproic acid	decreases expression	ISO	RGD:1564353	6480464	Valproic Acid results in decreased expression of NUP62CL mRNA	CTD	PMID:35594946
NUP62CL	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of NUP62CL mRNA	CTD	PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369\|PMID:29154799
NUP62CL	Human	valproic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
NUP62CL	Human	vorinostat	increases expression	EXP		6480464	vorinostat results in increased expression of NUP62CL mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUP62CL	Human	nucleocytoplasmic transport	involved_in	IEA	GO:0017056	150520179		GOC	GO_REF:0000108
NUP62CL	Human	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	150520179		UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUP62CL	Human	nuclear envelope	located_in	IEA	ARBA:ARBA00026328	150520179		UniProt	GO_REF:0000117
NUP62CL	Human	nuclear pore	part_of	IEA	InterPro:IPR026010	150520179		InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUP62CL	Human	protein binding	enables	IPI	UniProtKB:O15294\|UniProtKB:O95994	150520179	PMID:25416956	IntAct	PMID:25416956
NUP62CL	Human	protein binding	enables	IPI	UniProtKB:O15294-3	150520179	PMID:26871637	IntAct	PMID:26871637
NUP62CL	Human	protein binding	enables	IPI	UniProtKB:O95295\|UniProtKB:O95994\|UniProtKB:P78424	150520179	PMID:32296183	IntAct	PMID:32296183
NUP62CL	Human	protein binding	enables	IPI	UniProtKB:Q7Z3B4	150520179	PMID:31515488	IntAct	PMID:31515488
NUP62CL	Human	protein binding	enables	IPI	UniProtKB:O15294\|UniProtKB:Q7Z3B4	150520179	PMID:33961781	IntAct	PMID:33961781
NUP62CL	Human	protein binding	enables	IPI	UniProtKB:O15294	150520179	PMID:16189514	IntAct	PMID:16189514
NUP62CL	Human	structural constituent of nuclear pore	enables	IEA	InterPro:IPR026010	150520179		InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUP62CL	Human	Autism		IAGP	RGD:14351525	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106\|PMID:30208311

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10737800	PMID:12477932	PMID:14702039	PMID:15489334	PMID:15772651	PMID:16189514	PMID:18029348	PMID:19322201	PMID:20360068	PMID:21832049	PMID:21873635	PMID:25416956
PMID:26871637	PMID:27107012	PMID:28514442	PMID:28700943	PMID:31515488	PMID:32296183	PMID:33961781

NUP62CL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	107,123,427 - 107,206,433 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	107,123,427 - 107,206,433 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	106,366,657 - 106,449,663 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	106,253,358 - 106,336,200 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	X	106,837,965 - 106,921,027 (-)	NCBI		Celera
Cytogenetic Map	X	q22.3	NCBI
HuRef	X	95,994,426 - 96,076,159 (-)	NCBI		HuRef
CHM1_1	X	106,277,530 - 106,360,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	105,559,960 - 105,642,842 (-)	NCBI		T2T-CHM13v2.0

Nup62cl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	138,907,551 - 138,963,456 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	138,907,554 - 138,963,461 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	140,006,802 - 140,062,707 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	140,006,805 - 140,062,712 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	136,542,212 - 136,597,107 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	135,354,037 - 135,408,909 (-)	NCBI		MGSCv36	mm8
Celera	X	123,269,854 - 123,324,869 (-)	NCBI		Celera
Cytogenetic Map	X	F1	NCBI
cM Map	X	61.35	NCBI

Nup62cl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	108,457,043 - 108,513,525 (-)	NCBI		GRCr8
mRatBN7.2	X	103,668,458 - 103,724,957 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	103,668,455 - 103,724,081 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	X	111,333,274 - 111,390,023 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	111,334,252 - 111,365,849 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	53,207,455 - 53,264,220 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	127,752,322 - 127,812,950 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	44,203,467 - 44,259,295 (+)	NCBI		Celera
Cytogenetic Map	X	q32	NCBI

Nup62cl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955490	8,842,889 - 8,860,885 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955490	8,807,866 - 8,904,153 (+)	NCBI	ChiLan1.0	ChiLan1.0

NUP62CL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	106,605,716 - 106,722,143 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	106,609,317 - 106,725,744 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	96,222,802 - 96,300,219 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	106,600,838 - 106,676,569 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	106,600,819 - 106,638,256 (-)	Ensembl	panpan1.1		panPan2

NUP62CL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	80,708,829 - 80,787,441 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	80,729,667 - 80,784,034 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	66,827,950 - 66,922,117 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	82,352,349 - 82,446,668 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	X	79,815,275 - 79,909,439 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	81,526,810 - 81,620,971 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	81,318,837 - 81,412,574 (-)	NCBI		UU_Cfam_GSD_1.0

Nup62cl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	80,077,312 - 80,154,636 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936499	7,503,475 - 7,579,453 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUP62CL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	87,601,042 - 87,630,253 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	87,578,656 - 87,658,296 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	101,950,958 - 102,030,618 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NUP62CL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	94,952,017 - 95,033,089 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	94,951,636 - 94,998,052 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	20,032,182 - 20,116,664 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nup62cl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624803	9,424,628 - 9,487,626 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624803	9,391,282 - 9,487,066 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in NUP62CL
18 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	1861
Count of miRNA genes:	588
Interacting mature miRNAs:	659
Transcripts:	ENST00000372461, ENST00000372466, ENST00000421752, ENST00000432145, ENST00000484614
Prediction methods:	Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
596979989	GWAS1099508_H	memory performance, sex interaction measurement QTL GWAS1099508 (human)		0.000004	memory performance, sex interaction measurement		X	107161677	107161678	Human
597064951	GWAS1161025_H	alcoholic pancreatitis QTL GWAS1161025 (human)		2e-17	alcoholic pancreatitis		X	107123872	107123873	Human
596979991	GWAS1099510_H	memory performance, sex interaction measurement QTL GWAS1099510 (human)		0.000009	memory performance, sex interaction measurement		X	107191031	107191032	Human
597064949	GWAS1161023_H	alcoholic pancreatitis QTL GWAS1161023 (human)		1e-32	alcoholic pancreatitis		X	107131628	107131629	Human
597199957	GWAS1296031_H	memory performance, sex interaction measurement QTL GWAS1296031 (human)		0.000004	memory performance, sex interaction measurement		X	107191425	107191426	Human
597064952	GWAS1161026_H	alcoholic pancreatitis QTL GWAS1161026 (human)		1e-08	alcoholic pancreatitis		X	107158099	107158100	Human
597199958	GWAS1296032_H	memory performance, sex interaction measurement QTL GWAS1296032 (human)		0.000004	memory performance, sex interaction measurement		X	107191031	107191032	Human
597224918	GWAS1320992_H	COVID-19 QTL GWAS1320992 (human)		0.000001	COVID-19		X	107192186	107192187	Human
597135526	GWAS1231600_H	memory performance, sex interaction measurement QTL GWAS1231600 (human)		0.000004	memory performance, sex interaction measurement		X	107129640	107129641	Human
596984295	GWAS1103814_H	memory performance, sex interaction measurement QTL GWAS1103814 (human)		0.000009	memory performance, sex interaction measurement		X	107129640	107129641	Human
597062756	GWAS1158830_H	alcoholic pancreatitis QTL GWAS1158830 (human)		0.000007	alcoholic pancreatitis		X	107174072	107174073	Human
596989088	GWAS1108607_H	memory performance, sex interaction measurement QTL GWAS1108607 (human)		0.000004	memory performance, sex interaction measurement		X	107129640	107129641	Human
597335245	GWAS1431319_H	acute pancreatitis QTL GWAS1431319 (human)		6e-19	acute pancreatitis		X	107131628	107131629	Human
596986926	GWAS1106445_H	memory performance, sex interaction measurement QTL GWAS1106445 (human)		0.000004	memory performance, sex interaction measurement		X	107191031	107191032	Human
597133803	GWAS1229877_H	memory performance, sex interaction measurement QTL GWAS1229877 (human)		0.000009	memory performance, sex interaction measurement		X	107191031	107191032	Human
597133802	GWAS1229876_H	memory performance, sex interaction measurement QTL GWAS1229876 (human)		0.000009	memory performance, sex interaction measurement		X	107129640	107129641	Human
597135529	GWAS1231603_H	memory performance, sex interaction measurement QTL GWAS1231603 (human)		0.000004	memory performance, sex interaction measurement		X	107161677	107161678	Human
596986923	GWAS1106442_H	memory performance, sex interaction measurement QTL GWAS1106442 (human)		0.000004	memory performance, sex interaction measurement		X	107191425	107191426	Human

AL035123

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	106,420,644 - 106,420,889	UniSTS	GRCh37
Build 36	X	106,307,300 - 106,307,545	RGD	NCBI36
Celera	X	106,891,955 - 106,892,200	RGD
Cytogenetic Map	X	q22.3	UniSTS
HuRef	X	96,047,479 - 96,047,724	UniSTS

DXS1504

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	106,391,354 - 106,391,414	UniSTS	GRCh37
Build 36	X	106,278,010 - 106,278,070	RGD	NCBI36
Celera	X	106,862,662 - 106,862,722	RGD
Cytogenetic Map	X	q22.3	UniSTS
HuRef	X	96,019,203 - 96,019,263	UniSTS

stbA92F23T7

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	106,412,698 - 106,412,834	UniSTS	GRCh37
Build 36	X	106,299,354 - 106,299,490	RGD	NCBI36
Celera	X	106,884,008 - 106,884,144	RGD
Cytogenetic Map	X	q22.3	UniSTS
HuRef	X	96,039,614 - 96,039,750	UniSTS

L77251

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	106,412,508 - 106,412,599	UniSTS	GRCh37
Build 36	X	106,299,164 - 106,299,255	RGD	NCBI36
Celera	X	106,883,818 - 106,883,909	RGD
Cytogenetic Map	X	q22.3	UniSTS
HuRef	X	96,039,424 - 96,039,515	UniSTS

DXS6972E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	106,374,999 - 106,375,173	UniSTS	GRCh37
Build 36	X	106,261,655 - 106,261,829	RGD	NCBI36
Celera	X	106,846,307 - 106,846,481	RGD
Cytogenetic Map	6	q21	UniSTS
Cytogenetic Map	X	q22.3	UniSTS
HuRef	X	96,002,769 - 96,002,943	UniSTS
GeneMap99-GB4 RH Map	X	293.07	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system
1159	2383	2486	2056	4808	1713	2327	5	613	1700	455	2188	6609	5970	39	3613	1	844	1728	1604	172


RefSeq Transcripts	NG_021315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001433614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_017681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_033676	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_024452393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI702317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK000137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL136112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL390039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC016327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC017799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF805909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX105515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB448067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU178655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU178656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000372466 ⟹ ENSP00000361544

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	X	107,123,427 - 107,206,433 (-)	Ensembl

Ensembl Acc Id:

ENST00000421752 ⟹ ENSP00000405906

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	X	107,153,292 - 107,206,433 (-)	Ensembl

Ensembl Acc Id:

ENST00000432145 ⟹ ENSP00000408612

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	X	107,124,148 - 107,154,234 (-)	Ensembl

Ensembl Acc Id:

ENST00000484614 ⟹ ENSP00000433269

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	X	107,123,472 - 107,206,433 (-)	Ensembl

RefSeq Acc Id:

NM_017681 ⟹ NP_060151

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	107,123,427 - 107,206,433 (-)	NCBI
GRCh37	X	106,366,657 - 106,449,670 (-)	RGD
Build 36	X	106,253,358 - 106,336,200 (-)	NCBI Archive
Celera	X	106,837,965 - 106,921,027 (-)	RGD
HuRef	X	95,994,426 - 96,076,159 (-)	RGD
CHM1_1	X	106,277,530 - 106,360,560 (-)	NCBI
T2T-CHM13v2.0	X	105,559,960 - 105,642,842 (-)	NCBI

Sequence:

show sequence

AGTCTCGGTTAGCTTCACTTCAGCGGGAACCTGCCCACTAAGGAGGCCGATTCTTTCCGGCTCGAGCAGGTCCGGACCCGCCCCTCTGGCGTCTAGCAGTCTCGGAGGCCTGCCCGTATAGTTCAGGG
CCGGACAGCGAGCGGCGGCGACTTGCCAGTAAGGGTTTGGAGTCATCAGCAGGTTTAATTTTGGAGGAACTTTACAGGTTTGGCTCCAGCAGCTGCTGTTGCCACCACCACTAGTTCAAGCACCATGC
AGTTTACCTCAATATCAAATTCTTTGACCTCCACTGCTGCTATTGGGCTCTCATTTACAACTTCAACGACTACCACCGCCACTTTCACCACCAACACTACTACCACAATCACCAGTGGCTTTACTGTG
AACCAAAACCAACTGTTATCAAGAGGGTTTGAAAACCTTGTACCTTATACTTCAACTGTTAGTGTAGTAGCAACTCCTGTGATGACATATGGTCATCTGGAGGGTCTTATAAATGAGTGGAACCTTGA
GCTGGAAGATCAAGAGAAGTACTTTCTTCTCCAGGCCACTCAGGTCAATGCTTGGGACCATACATTGATTGAGAATGGTGAGATGATTCGTATTTTACATGGAGAAGTGAACAAAGTGAAACTGGATC
AGAAAAGATTGGAACAAGAATTGGATTTTATCCTGTCACAGCAGCAGGAACTAGAATTTCTGTTGACTTATTTAGAGGAGTCTACGCGTGACCAGAGTGGACTTCATTATCTGCAGGATGCAGATGAG
GAGCATGTGGAGATCTCCACCAGATCTGCAGAATTCTGAATGCCCATATGGACTCCCTGCAGTGGATTGATCGGAATTCAGGCATGCTGCGAAGGAAGGTAGAAGTGGTAACACGGGTTTTCGAGGAT
TATCGTCACGAGGAGCATGCACACAATGTCAACACTGCTTTTTAGTGAATGACCATATCTTCAGCATGTCGTTTCTGGATTATTACCTACAAATTCTGATGTTAAATAGAGTAGTATTTATACTTAAT
ATTTCATCTTGATCATAATGAATTGTGCATCCTTTTTTTCATTTAAGTATTGTACTGTTGAGAATTATACCTTAGTTTTGTTTTTAGTATTAGAAAATCAAAATTATACTAGCCCCTTTGTCCAGACA
GCAACCTCTTAGATGCTGACTCTATATGTGTAATTTATGTCTTACTCTCCCTGGCATCAGTACACATCATCCTTCTCACTCCAGTTGAATCATAGGGTGATGTCTGCCAAAAGTACATGCCAACCTAT
ATAGTGCTAGATACTGTAAAGTCTCTTCTCCTCAAAGGAACCTACTGTCTAGTTTGAGATATAATTAATGCTTGTCTGCATAAAAACAATATAGATAATATAAAGAAGTGCAGTATGAATTATAGAAA
GTGTGTTATAGAGATTCAGAGCAGGGAGGAAAAGTTAGGGTAGATTATTATTAAAGGGTTAAGGAAAGGTAAGTTTCAAGGAATTTGGTTATTTTTAATGTATGGATATACTGGCATTTTATTTGGTT
TTAGCATATGATTTATAGTTGGTGATTTCCGTATATTTGTTTGTTTTTCTTTTTTTTTGTTTGTTTGTTTTGTTTTGTTTTAAATAAGCCTTGTTCTTAGGTTTGGAACAGTCTGGTCTCCTGTGTTT
CATGTTTCACCTAAGTCATAAATAAAGGTAATGTCCTAAAAAAAAACATGTAATACTGAAATTAACTATTAAAAGTTTTTAAGTGACTAGA

hide sequence

RefSeq Acc Id:

NR_033676

RefSeq Status:

REVIEWED

Type:

NON-CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	107,123,427 - 107,206,433 (-)	NCBI
GRCh37	X	106,366,657 - 106,449,670 (-)	RGD
Celera	X	106,837,965 - 106,921,027 (-)	RGD
HuRef	X	95,994,426 - 96,076,159 (-)	RGD
CHM1_1	X	106,277,530 - 106,360,560 (-)	NCBI
T2T-CHM13v2.0	X	105,559,960 - 105,642,842 (-)	NCBI

Sequence:

show sequence

AGTCTCGGTTAGCTTCACTTCAGCGGGAACCTGCCCACTAAGGAGGCCGATTCTTTCCGGCTCGAGCAGGTCCGGACCCGCCCCTCTGGCGTCTAGCAGTCTCGGAGGCCTGCCCGTATAGTTCAGGG
CCGGACAGCGAGCGGCGGCGACTTGCCAGTAAGGTTTGGCTCCAGCAGCTGCTGTTGCCACCACCACTAGTTCAAGCACCATGCAGTTTACCTCAATATCAAATTCTTTGACCTCCACTGCTGCTATT
GGGCTCTCATTTACAACTTCAACGACTACCACCGCCACTTTCACCACCAACACTACTACCACAATCACCAGTGGCTTTACTGTGAACCAAAACCAACTGTTATCAAGAGGGTTTGAAAACCTTGTACC
TTATACTTCAACTGTTAGATTCGTATTTTACATGGAGAAGTGAACAAAGTGAAACTGGATCAGAAAAGATTGGAACAAGAATTGGATTTTATCCTGTCACAGCAGCAGGAACTAGAATTTCTGTTGAC
TTATTTAGAGGAGTCTACGCGTGACCAGAGTGGACTTCATTATCTGCAGGATGCAGATGAGGAGCATGTGGAGATCTCCACCAGATCTGCAGAATTCTGAATGCCCATATGGACTCCCTGCAGTGGAT
TGATCGGAATTCAGGCATGCTGCGAAGGAAGGTAGAAGTGGTAACACGGGTTTTCGAGGATTATCGTCACGAGGAGCATGCACACAATGTCAACACTGCTTTTTAGTGAATGACCATATCTTCAGCAT
GTCGTTTCTGGATTATTACCTACAAATTCTGATGTTAAATAGAGTAGTATTTATACTTAATATTTCATCTTGATCATAATGAATTGTGCATCCTTTTTTTCATTTAAGTATTGTACTGTTGAGAATTA
TACCTTAGTTTTGTTTTTAGTATTAGAAAATCAAAATTATACTAGCCCCTTTGTCCAGACAGCAACCTCTTAGATGCTGACTCTATATGTGTAATTTATGTCTTACTCTCCCTGGCATCAGTACACAT
CATCCTTCTCACTCCAGTTGAATCATAGGGTGATGTCTGCCAAAAGTACATGCCAACCTATATAGTGCTAGATACTGTAAAGTCTCTTCTCCTCAAAGGAACCTACTGTCTAGTTTGAGATATAATTA
ATGCTTGTCTGCATAAAAACAATATAGATAATATAAAGAAGTGCAGTATGAATTATAGAAAGTGTGTTATAGAGATTCAGAGCAGGGAGGAAAAGTTAGGGTAGATTATTATTAAAGGGTTAAGGAAA
GGTAAGTTTCAAGGAATTTGGTTATTTTTAATGTATGGATATACTGGCATTTTATTTGGTTTTAGCATATGATTTATAGTTGGTGATTTCCGTATATTTGTTTGTTTTTCTTTTTTTTTGTTTGTTTG
TTTTGTTTTGTTTTAAATAAGCCTTGTTCTTAGGTTTGGAACAGTCTGGTCTCCTGTGTTTCATGTTTCACCTAAGTCATAAATAAAGGTAATGTCCTAAAAAAAAACATGTAATACTGAAATTAACT
ATTAAAAGTTTTTAAGTGACTAGA

hide sequence


Protein RefSeqs	NP_001420543	(Get FASTA)	NCBI Sequence Viewer
	NP_060151	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH16327	(Get FASTA)	NCBI Sequence Viewer
	AAH17799	(Get FASTA)	NCBI Sequence Viewer
	ALQ34113	(Get FASTA)	NCBI Sequence Viewer
	ALQ34114	(Get FASTA)	NCBI Sequence Viewer
	BAA90968	(Get FASTA)	NCBI Sequence Viewer
	EAX02718	(Get FASTA)	NCBI Sequence Viewer
	EAX02719	(Get FASTA)	NCBI Sequence Viewer
	EAX02720	(Get FASTA)	NCBI Sequence Viewer
	EAX02721	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000361544
	ENSP00000361544.4
	ENSP00000433269.1
GenBank Protein	Q9H1M0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_060151 ⟸ NM_017681
- UniProtKB:	Q8WVL6 (UniProtKB/Swiss-Prot), D3DUX4 (UniProtKB/Swiss-Prot), Q9NXP2 (UniProtKB/Swiss-Prot), Q9H1M0 (UniProtKB/Swiss-Prot), A0A0S2Z5E8 (UniProtKB/TrEMBL), A0A0S2Z5B5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVSVVATPVMTYGHLEGLINEWNLELEDQEKYFLLQATQVNAWDHTLIENGEMIRILHGEVNKVKL DQKRLEQELDFILSQQQELEFLLTYLEESTRDQSGLHYLQDADEEHVEISTRSAEF hide sequence

Ensembl Acc Id:

ENSP00000361544 ⟸ ENST00000372466

Ensembl Acc Id:

ENSP00000433269 ⟸ ENST00000484614

Ensembl Acc Id:

ENSP00000408612 ⟸ ENST00000432145

Ensembl Acc Id:

ENSP00000405906 ⟸ ENST00000421752

Protein Domains

Nucleoporin NSP1-like C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9H1M0-F1-model_v2	AlphaFold	Q9H1M0	1-184	view protein structure

RGD ID:

6808614

Promoter ID:

HG_KWN:67701

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid

Transcripts:

ENST00000336387, ENST00000372461, ENST00000372465, NM_001169154, NM_173494, NR_033676, OTTHUMT00000057828, OTTHUMT00000057830, UC004END.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	X	106,335,616 - 106,336,317 (+)	MPROMDB

RGD ID:

13627798

Promoter ID:

EPDNEW_H29174

Type:

initiation region

Name:

NUP62CL_1

Description:

nucleoporin 62 C-terminal like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H29177

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	107,206,433 - 107,206,493	EPDNEW

Database	Acc Id	Source(s)
COSMIC	NUP62CL	COSMIC
Ensembl Genes	ENSG00000198088	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000372466	ENTREZGENE
	ENST00000372466.8	UniProtKB/Swiss-Prot
	ENST00000484614	ENTREZGENE
	ENST00000484614.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
GTEx	ENSG00000198088	GTEx
HGNC ID	HGNC:25960	ENTREZGENE
Human Proteome Map	NUP62CL	Human Proteome Map
InterPro	NSP1/NUP62	UniProtKB/Swiss-Prot
	Nucleoporin_NSP1_C	UniProtKB/Swiss-Prot
KEGG Report	hsa:54830	UniProtKB/Swiss-Prot
NCBI Gene	54830	ENTREZGENE
PANTHER	NUCLEOPORIN 62 C-TERMINAL LIKE	UniProtKB/Swiss-Prot
	PTHR12084	UniProtKB/Swiss-Prot
Pfam	Nsp1_C	UniProtKB/Swiss-Prot
PharmGKB	PA145148360	PharmGKB
UniProt	A0A0S2Z5B5	ENTREZGENE, UniProtKB/TrEMBL
	A0A0S2Z5E8	ENTREZGENE, UniProtKB/TrEMBL
	D3DUX4	ENTREZGENE
	H0Y6X7_HUMAN	UniProtKB/TrEMBL
	N62CL_HUMAN	UniProtKB/Swiss-Prot
	Q5JSN5_HUMAN	UniProtKB/TrEMBL
	Q8WVL6	ENTREZGENE
	Q9H1M0	ENTREZGENE
	Q9NXP2	ENTREZGENE
UniProt Secondary	D3DUX4	UniProtKB/Swiss-Prot
	Q8WVL6	UniProtKB/Swiss-Prot
	Q9NXP2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-07	NUP62CL	nucleoporin 62 C-terminal like		nucleoporin 62kDa C-terminal like	Symbol and/or name change	5135510	APPROVED
2011-09-13	NUP62CL	nucleoporin 62kDa C-terminal like	NUP62CL	nucleoporin 62kDa C-terminal like	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar