Symbol:
LRATD1
Name:
LRAT domain containing 1
RGD ID:
1602648
HGNC Page
HGNC:20743
Description:
Involved in cell morphogenesis and cell motility. Predicted to be located in cytoplasm.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FAM84A; family with sequence similarity 84 member A; family with sequence similarity 84, member A; FLJ35392; neurologic sensory protein 1; neurological/sensory 1; NSE1; PP11517
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Lratd1 (LRAT domain containing 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Lratd1 (LRAT domain containing 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Lratd1 (LRAT domain containing 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
LRATD1 (LRAT domain containing 1) NCBI
Ortholog
Canis lupus familiaris (dog):
LRATD1 (LRAT domain containing 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lratd1 (LRAT domain containing 1) NCBI
Ortholog
Sus scrofa (pig):
LRATD1 (LRAT domain containing 1) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
LRATD1 (LRAT domain containing 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Lratd1 (LRAT domain containing 1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Lratd1 (LRAT domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lratd1 (LRAT domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fam84a (family with sequence similarity 84 member A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
lratd1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 14,632,717 - 14,651,916 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 14,632,700 - 14,650,814 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 14,772,841 - 14,792,040 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 14,690,307 - 14,693,898 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 14,690,800 - 14,698,160 (+) NCBI Celera Cytogenetic Map 2 p24.3 NCBI HuRef 2 14,623,272 - 14,630,632 (+) NCBI HuRef CHM1_1 2 14,702,276 - 14,709,636 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 14,663,504 - 14,682,703 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
LRATD1 Human 1,2-dimethylhydrazine increases expression ISO Lratd1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FAM84A mRNA CTD PMID:22206623 LRATD1 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of LRATD1 mRNA CTD PMID:30165855 LRATD1 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of LRATD1 mRNA CTD PMID:31614463 LRATD1 Human 17beta-estradiol increases expression ISO Lratd1 (Mus musculus) 6480464 Estradiol results in increased expression of LRATD1 mRNA CTD PMID:19484750 LRATD1 Human 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO Lratd1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 LRATD1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LRATD1 mRNA CTD PMID:32109520 LRATD1 Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 LRATD1 Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of LRATD1 mRNA CTD PMID:37199045 LRATD1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of LRATD1 mRNA CTD PMID:28628672 LRATD1 Human 4,4'-sulfonyldiphenol decreases methylation ISO Lratd1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of LRATD1 exon CTD PMID:33297965 LRATD1 Human 4,4'-sulfonyldiphenol affects methylation ISO Lratd1 (Mus musculus) 6480464 bisphenol S affects the methylation of FAM84A gene CTD PMID:31683443 LRATD1 Human 5-fluorouracil increases expression EXP 6480464 Fluorouracil results in increased expression of LRATD1 mRNA CTD PMID:24737281 LRATD1 Human acrylamide increases expression ISO Lratd1 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of LRATD1 mRNA CTD PMID:28959563 LRATD1 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of LRATD1 gene CTD PMID:27153756 LRATD1 Human alpha-Zearalanol multiple interactions ISO Lratd1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FAM84A mRNA CTD PMID:35163327 LRATD1 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of LRATD1 mRNA CTD PMID:24449571 LRATD1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of FAM84A 3' UTR and Benzo(a)pyrene affects the methylation of FAM84A 5' UTR CTD PMID:27901495 LRATD1 Human benzo[a]pyrene decreases expression ISO Lratd1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LRATD1 mRNA CTD PMID:19770486 LRATD1 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of FAM84A promoter CTD PMID:27901495 LRATD1 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Lratd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LRATD1 mRNA CTD PMID:39150890 LRATD1 Human bisphenol A multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of LRATD1 mRNA CTD PMID:28628672 LRATD1 Human bisphenol A increases expression ISO Lratd1 (Mus musculus) 6480464 bisphenol A results in increased expression of LRATD1 mRNA CTD PMID:32156529 LRATD1 Human bisphenol A decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of LRATD1 mRNA CTD PMID:25181051 LRATD1 Human bisphenol A decreases expression ISO Lratd1 (Mus musculus) 6480464 bisphenol A results in decreased expression of FAM84A mRNA CTD PMID:30951980 LRATD1 Human bisphenol F decreases expression ISO Lratd1 (Mus musculus) 6480464 bisphenol F results in decreased expression of FAM84A mRNA CTD PMID:30951980 LRATD1 Human bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of LRATD1 gene CTD PMID:31601247 LRATD1 Human butanal increases expression EXP 6480464 butyraldehyde results in increased expression of LRATD1 mRNA CTD PMID:26079696 LRATD1 Human Butylbenzyl phthalate multiple interactions ISO Lratd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LRATD1 mRNA CTD PMID:39150890 LRATD1 Human C60 fullerene decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of LRATD1 mRNA CTD PMID:19167457 LRATD1 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of FAM84A mRNA CTD PMID:38382870 LRATD1 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of LRATD1 mRNA CTD PMID:26485663 LRATD1 Human cefaloridine increases expression ISO Lratd1 (Rattus norvegicus) 6480464 Cephaloridine results in increased expression of LRATD1 mRNA CTD PMID:18500788 LRATD1 Human choline multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593 LRATD1 Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of LRATD1 mRNA CTD PMID:38479592 LRATD1 Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of LRATD1 mRNA CTD PMID:20971185 LRATD1 Human copper atom decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 Copper results in decreased expression of LRATD1 mRNA CTD PMID:30556269 LRATD1 Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in decreased expression of LRATD1 mRNA CTD PMID:20971185 LRATD1 Human copper(0) decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 Copper results in decreased expression of LRATD1 mRNA CTD PMID:30556269 LRATD1 Human cyanocob(III)alamin multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593 LRATD1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of LRATD1 mRNA CTD PMID:28628672 LRATD1 Human dibutyl phthalate decreases expression ISO Lratd1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of LRATD1 mRNA CTD PMID:21266533 LRATD1 Human dibutyl phthalate multiple interactions ISO Lratd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LRATD1 mRNA CTD PMID:39150890 LRATD1 Human diethyl phthalate multiple interactions ISO Lratd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LRATD1 mRNA CTD PMID:39150890 LRATD1 Human diisobutyl phthalate multiple interactions ISO Lratd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LRATD1 mRNA CTD PMID:39150890 LRATD1 Human diisononyl phthalate multiple interactions ISO Lratd1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LRATD1 mRNA CTD PMID:39150890 LRATD1 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 LRATD1 Human doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of LRATD1 mRNA CTD PMID:30031762 LRATD1 Human entinostat decreases expression EXP 6480464 entinostat results in decreased expression of LRATD1 mRNA CTD PMID:26272509 LRATD1 Human entinostat multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LRATD1 mRNA CTD PMID:27188386 LRATD1 Human ethanol multiple interactions ISO Lratd1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of LRATD1 mRNA CTD PMID:30319688 LRATD1 Human folic acid multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593 LRATD1 Human fulvestrant multiple interactions EXP 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of LRATD1 gene CTD PMID:31601247 LRATD1 Human furan increases expression ISO Lratd1 (Rattus norvegicus) 6480464 furan results in increased expression of LRATD1 mRNA CTD PMID:27387713 LRATD1 Human genistein increases expression ISO Lratd1 (Mus musculus) 6480464 Genistein results in increased expression of LRATD1 mRNA CTD PMID:32186404 LRATD1 Human glycine betaine multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593 LRATD1 Human gold atom increases expression EXP 6480464 Gold results in increased expression of LRATD1 mRNA CTD PMID:25523186 LRATD1 Human gold(0) increases expression EXP 6480464 Gold results in increased expression of LRATD1 mRNA CTD PMID:25523186 LRATD1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of LRATD1 mRNA CTD PMID:28628672 LRATD1 Human L-methionine multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593 LRATD1 Human methamphetamine affects expression ISO Lratd1 (Rattus norvegicus) 6480464 Methamphetamine affects the expression of LRATD1 mRNA CTD PMID:19564919 LRATD1 Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of LRATD1 mRNA CTD PMID:28001369 LRATD1 Human ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of LRATD1 mRNA CTD PMID:22124623 LRATD1 Human paracetamol affects expression ISO Lratd1 (Mus musculus) 6480464 Acetaminophen affects the expression of LRATD1 mRNA CTD PMID:17562736 LRATD1 Human paracetamol increases expression ISO Lratd1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of FAM84A mRNA CTD PMID:33387578 LRATD1 Human perfluorooctanoic acid multiple interactions ISO Lratd1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FAM84A mRNA CTD PMID:35163327 LRATD1 Human phenobarbital multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA more ... CTD PMID:19482888 more ... LRATD1 Human phenobarbital increases expression ISO Lratd1 (Mus musculus) 6480464 Phenobarbital results in increased expression of LRATD1 mRNA and Phenobarbital results in increased expression of LRATD1 protein CTD PMID:19482888 more ... LRATD1 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LRATD1 mRNA CTD PMID:27188386 LRATD1 Human pirinixic acid multiple interactions ISO Lratd1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of LRATD1 mRNA CTD PMID:19710929 LRATD1 Human pirinixic acid decreases expression ISO Lratd1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of LRATD1 mRNA CTD PMID:17426115 and PMID:20813756 LRATD1 Human propanal increases expression EXP 6480464 propionaldehyde results in increased expression of LRATD1 mRNA CTD PMID:26079696 LRATD1 Human propiconazole increases expression ISO Lratd1 (Mus musculus) 6480464 propiconazole results in increased expression of LRATD1 mRNA CTD PMID:21278054 LRATD1 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of LRATD1 mRNA CTD PMID:23557933 LRATD1 Human rotenone increases expression ISO Lratd1 (Mus musculus) 6480464 Rotenone results in increased expression of FAM84A mRNA CTD PMID:32937126 LRATD1 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 LRATD1 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of LRATD1 mRNA CTD PMID:23806026 and PMID:25895662 LRATD1 Human sodium arsenite decreases expression ISO Lratd1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of LRATD1 mRNA CTD PMID:37682722 LRATD1 Human tetraphene decreases expression ISO Lratd1 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of LRATD1 mRNA CTD PMID:26377693 LRATD1 Human thioacetamide increases expression ISO Lratd1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of LRATD1 mRNA CTD PMID:34492290 LRATD1 Human titanium dioxide decreases expression ISO Lratd1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of FAM84A mRNA and titanium dioxide results in decreased expression of LRATD1 mRNA CTD PMID:23557971 and PMID:29264374 LRATD1 Human titanium dioxide decreases methylation ISO Lratd1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FAM84A gene CTD PMID:35295148 LRATD1 Human trichostatin A decreases expression EXP 6480464 trichostatin A results in decreased expression of LRATD1 mRNA CTD PMID:24935251 LRATD1 Human triclosan increases expression EXP 6480464 Triclosan results in increased expression of LRATD1 mRNA CTD PMID:30510588 LRATD1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of LRATD1 mRNA CTD PMID:19101580 more ... LRATD1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of LRATD1 mRNA CTD PMID:28001369 LRATD1 Human vinclozolin increases expression ISO Lratd1 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of LRATD1 mRNA CTD PMID:20566332 LRATD1 Human zinc atom multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593 LRATD1 Human zinc(0) multiple interactions ISO Lratd1 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of LRATD1 mRNA CTD PMID:33549593
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2-palmitoylglycerol (EXP) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (EXP) acrylamide (ISO) aflatoxin B1 (EXP) alpha-Zearalanol (ISO) antirheumatic drug (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) butanal (EXP) Butylbenzyl phthalate (ISO) C60 fullerene (ISO) cadmium dichloride (EXP) calcitriol (EXP) cefaloridine (ISO) choline (ISO) chromium(6+) (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) cyanocob(III)alamin (ISO) dexamethasone (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (EXP) doxorubicin (EXP) entinostat (EXP) ethanol (ISO) folic acid (ISO) fulvestrant (EXP) furan (ISO) genistein (ISO) glycine betaine (ISO) gold atom (EXP) gold(0) (EXP) indometacin (EXP) L-methionine (ISO) methamphetamine (ISO) methylmercury chloride (EXP) ochratoxin A (EXP) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (EXP) pirinixic acid (ISO) propanal (EXP) propiconazole (ISO) resveratrol (EXP) rotenone (ISO) SB 431542 (EXP) silicon dioxide (EXP) sodium arsenite (ISO) tetraphene (ISO) thioacetamide (ISO) titanium dioxide (ISO) trichostatin A (EXP) triclosan (EXP) valproic acid (EXP) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
LRATD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 14,632,717 - 14,651,916 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 14,632,700 - 14,650,814 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 14,772,841 - 14,792,040 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 14,690,307 - 14,693,898 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 14,690,800 - 14,698,160 (+) NCBI Celera Cytogenetic Map 2 p24.3 NCBI HuRef 2 14,623,272 - 14,630,632 (+) NCBI HuRef CHM1_1 2 14,702,276 - 14,709,636 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 14,663,504 - 14,682,703 (+) NCBI T2T-CHM13v2.0
Lratd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 14,197,599 - 14,202,039 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 14,196,831 - 14,202,055 (-) Ensembl GRCm39 Ensembl GRCm38 12 14,147,598 - 14,152,038 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 14,146,830 - 14,152,054 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 14,154,404 - 14,158,844 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 14,173,138 - 14,177,578 (-) NCBI MGSCv36 mm8 Celera 12 14,497,016 - 14,501,453 (-) NCBI Celera Cytogenetic Map 12 A1.1 NCBI cM Map 12 6.93 NCBI
Lratd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 42,646,515 - 42,650,988 (-) NCBI GRCr8 mRatBN7.2 6 36,916,969 - 36,922,143 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 36,913,469 - 36,922,319 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 37,229,678 - 37,234,169 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 37,544,351 - 37,548,842 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 36,994,065 - 36,998,553 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 39,358,285 - 39,363,458 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 39,358,985 - 39,363,458 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 48,123,155 - 48,128,472 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 37,782,015 - 37,786,488 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 37,785,856 - 37,789,250 (-) NCBI Celera 6 36,259,766 - 36,264,239 (-) NCBI Celera Cytogenetic Map 6 q15 NCBI
Lratd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955487 8,452,621 - 8,454,585 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955487 8,452,413 - 8,454,585 (+) NCBI ChiLan1.0 ChiLan1.0
LRATD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 111,875,720 - 111,878,956 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 111,879,692 - 111,884,222 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 14,630,016 - 14,635,367 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 Ensembl 2A 14,767,049 - 14,767,927 (+) Ensembl panpan1.1 panPan2
LRATD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 10,658,511 - 10,660,730 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 10,659,777 - 10,660,685 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 10,601,907 - 10,610,106 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 10,781,633 - 10,789,835 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 10,782,798 - 10,783,706 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 10,646,902 - 10,655,099 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 10,657,481 - 10,665,043 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 10,679,556 - 10,687,756 (+) NCBI UU_Cfam_GSD_1.0
Lratd1
LRATD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 122,716,040 - 122,731,791 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 122,716,029 - 122,720,957 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 143,905,448 - 143,910,293 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LRATD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 93,016,709 - 93,022,670 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 93,020,404 - 93,021,282 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 19,244,941 - 19,251,510 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lratd1
.
Predicted Target Of
Count of predictions: 3596 Count of miRNA genes: 1116 Interacting mature miRNAs: 1364 Transcripts: ENST00000295092, ENST00000331243, ENST00000464947, ENST00000497769 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
407220214 GWAS869190_H trauma exposure measurement QTL GWAS869190 (human) 0.000002 trauma exposure measurement 2 14640007 14640008 Human
SHGC-36750
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 14,777,204 - 14,777,328 UniSTS GRCh37 Build 36 2 14,694,655 - 14,694,779 RGD NCBI36 Celera 2 14,695,194 - 14,695,318 RGD Cytogenetic Map 2 p24.3 UniSTS HuRef 2 14,627,666 - 14,627,790 UniSTS
RH99165
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 14,775,965 - 14,776,084 UniSTS GRCh37 Build 36 2 14,693,416 - 14,693,535 RGD NCBI36 Celera 2 14,693,955 - 14,694,074 RGD Cytogenetic Map 2 p24.3 UniSTS HuRef 2 14,626,427 - 14,626,546 UniSTS GeneMap99-GB4 RH Map 2 56.45 UniSTS
RH78874
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 14,779,978 - 14,780,098 UniSTS GRCh37 Build 36 2 14,697,429 - 14,697,549 RGD NCBI36 Celera 2 14,697,968 - 14,698,088 RGD Cytogenetic Map 2 p24.3 UniSTS HuRef 2 14,630,440 - 14,630,560 UniSTS NCBI RH Map 2 65.3 UniSTS
D2S1661E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 14,777,223 - 14,777,338 UniSTS GRCh37 Build 36 2 14,694,674 - 14,694,789 RGD NCBI36 Celera 2 14,695,213 - 14,695,328 RGD Cytogenetic Map 2 p24.3 UniSTS HuRef 2 14,627,685 - 14,627,800 UniSTS GeneMap99-GB4 RH Map 2 56.45 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2418
2788
2228
4922
1700
2258
5
607
1209
447
2231
6536
5742
34
3719
1
837
1713
1542
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000295092 ⟹ ENSP00000295092
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 14,632,717 - 14,640,041 (+) Ensembl
Ensembl Acc Id:
ENST00000331243 ⟹ ENSP00000330681
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 14,632,700 - 14,637,227 (+) Ensembl
Ensembl Acc Id:
ENST00000464947
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 14,635,496 - 14,649,641 (+) Ensembl
Ensembl Acc Id:
ENST00000497769
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 14,635,091 - 14,650,814 (+) Ensembl
RefSeq Acc Id:
NM_001369364 ⟹ NP_001356293
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 14,632,717 - 14,640,041 (+) NCBI T2T-CHM13v2.0 2 14,663,504 - 14,670,828 (+) NCBI
Sequence:
AAAGCAGAGCCGAGCCGGGACTGTCCAGTGGGAGCAGGCGCCCCGGCCAGCGCAGACCTGGAGGCGCACGGGCGCCGCACCGCACGATTCGGCTCGGGGTAGAGCGGAGCCGCAGCCCCACGCGCAGC
hide sequence
RefSeq Acc Id:
NM_145175 ⟹ NP_660158
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 14,632,717 - 14,640,041 (+) NCBI GRCh37 2 14,772,810 - 14,780,170 (+) RGD Build 36 2 14,690,307 - 14,693,898 (+) NCBI Archive Celera 2 14,690,800 - 14,698,160 (+) RGD HuRef 2 14,623,272 - 14,630,632 (+) RGD CHM1_1 2 14,702,276 - 14,709,636 (+) NCBI T2T-CHM13v2.0 2 14,663,504 - 14,670,828 (+) NCBI
Sequence:
AAAGCAGAGCCGAGCCGGGACTGTCCAGTGGGAGCAGGCGCCCCGGCCAGCGCAGACCTGGAGG
hide sequence
RefSeq Acc Id:
NR_144632
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 14,632,717 - 14,651,916 (+) NCBI T2T-CHM13v2.0 2 14,663,504 - 14,682,703 (+) NCBI
Sequence:
AAAGCAGAGCCGAGCCGGGACTGTCCAGTGGGAGCAGGCGCCCCGGCCAGCGCAGACCTGGAGGCGCACGGGCGCCGCACCGCACGATTCGGCTCGGGGTAGAGCGGAGCCGCAGCCCCACGCGCAGC
hide sequence
RefSeq Acc Id:
NP_660158 ⟸ NM_145175
- UniProtKB:
Q8NAH7 (UniProtKB/Swiss-Prot), Q86UZ2 (UniProtKB/Swiss-Prot), A6NP76 (UniProtKB/Swiss-Prot), Q8TAM5 (UniProtKB/Swiss-Prot), Q96KN4 (UniProtKB/Swiss-Prot), B2RB24 (UniProtKB/TrEMBL)
- Sequence:
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLEL
hide sequence
RefSeq Acc Id:
NP_001356293 ⟸ NM_001369364
- UniProtKB:
Q96KN4 (UniProtKB/Swiss-Prot), Q8NAH7 (UniProtKB/Swiss-Prot), Q86UZ2 (UniProtKB/Swiss-Prot), A6NP76 (UniProtKB/Swiss-Prot), Q8TAM5 (UniProtKB/Swiss-Prot), B2RB24 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000330681 ⟸ ENST00000331243
Ensembl Acc Id:
ENSP00000295092 ⟸ ENST00000295092
RGD ID: 6859670 Promoter ID: EPDNEW_H3000 Type: initiation region Name: FAM84A_1 Description: family with sequence similarity 84 member A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 2 14,632,722 - 14,632,782 EPDNEW
RGD ID: 6797471 Promoter ID: HG_KWN:31578 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: ENST00000331243, ENST00000359969, OTTHUMT00000239308 Position: Human Assembly Chr Position (strand) Source Build 36 2 14,690,041 - 14,690,541 (+) MPROMDB
RGD ID: 6797472 Promoter ID: HG_KWN:31579 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: ENST00000381456, OTTHUMT00000323612, OTTHUMT00000323614, UC010EXK.1 Position: Human Assembly Chr Position (strand) Source Build 36 2 14,692,041 - 14,692,541 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-03-05
LRATD1
LRAT domain containing 1
FAM84A
family with sequence similarity 84 member A
Symbol and/or name change
5135510 APPROVED
2015-11-24
FAM84A
family with sequence similarity 84 member A
family with sequence similarity 84, member A
Symbol and/or name change
5135510 APPROVED
