Advanced Search (OLGA)

Gene: SERP1 (stress associated endoplasmic reticulum protein 1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

SERP1

Name:

stress associated endoplasmic reticulum protein 1

RGD ID:

1601762

HGNC Page

HGNC:10759

Description:

Predicted to be involved in endoplasmic reticulum unfolded protein response. Predicted to act upstream of or within several processes, including positive regulation of organ growth; positive regulation of peptide hormone secretion; and positive regulation of translation. Located in cytoplasmic microtubule.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC117327; MGC133321; MGC133322; RAMP4; ribosome associated membrane protein 4; ribosome-attached membrane protein 4; stress-associated endoplasmic reticulum protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	150,541,998 - 150,546,496 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	150,541,998 - 150,603,228 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	150,259,785 - 150,264,283 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	151,742,470 - 151,747,118 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	148,672,684 - 148,677,330 (-)	NCBI		Celera
Cytogenetic Map	3	q25.1	NCBI
HuRef	3	147,633,487 - 147,638,133 (-)	NCBI		HuRef
CHM1_1	3	150,222,832 - 150,227,480 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	153,293,254 - 153,297,751 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SERP1	Human	glycogen storage disease XV		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Glycogen storage disease XV	ClinVar	PMID:20357282 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SERP1	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Serp1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SERP1 mRNA	CTD	PMID:22206623
SERP1	Human	1,2-dimethylhydrazine	decreases expression	ISO	Serp1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of SERP1 mRNA	CTD	PMID:22206623
SERP1	Human	17alpha-ethynylestradiol	affects expression	ISO	Serp1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of SERP1 mRNA	CTD	PMID:17555576
SERP1	Human	17alpha-ethynylestradiol	affects expression	ISO	Serp1 (Rattus norvegicus)	6480464	Ethinyl Estradiol affects the expression of SERP1 mRNA	CTD	PMID:26865667
SERP1	Human	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	Serp1 (Mus musculus)	6480464	2 more ...	CTD	PMID:30294300
SERP1	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Serp1 (Mus musculus)	6480464	AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of SERP1 mRNA]	CTD	PMID:15034205
SERP1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SERP1 mRNA	CTD	PMID:34747641
SERP1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Serp1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SERP1 mRNA	CTD	PMID:15034205
SERP1	Human	3H-1,2-dithiole-3-thione	decreases expression	ISO	Serp1 (Rattus norvegicus)	6480464	1 and 2-dithiol-3-thione results in decreased expression of SERP1 mRNA	CTD	PMID:19162173
SERP1	Human	4,4'-diaminodiphenylmethane	increases expression	ISO	Serp1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of SERP1 mRNA	CTD	PMID:18648102
SERP1	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Serp1 (Mus musculus)	6480464	bisphenol S results in increased expression of SERP1 mRNA	CTD	PMID:39298647
SERP1	Human	acetamide	decreases expression	ISO	Serp1 (Rattus norvegicus)	6480464	acetamide results in decreased expression of SERP1 mRNA	CTD	PMID:31881176
SERP1	Human	acrylamide	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Acrylamide results in increased expression of SERP1 mRNA	CTD	PMID:28959563
SERP1	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of SERP1 gene	CTD	PMID:27153756
SERP1	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of SERP1 mRNA	CTD	PMID:33167477
SERP1	Human	ammonium chloride	affects expression	ISO	Serp1 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of SERP1 mRNA	CTD	PMID:16483693
SERP1	Human	arsane	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SERP1 mRNA	CTD	PMID:39836092
SERP1	Human	arsenic atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SERP1 mRNA	CTD	PMID:39836092
SERP1	Human	benzo[a]pyrene	multiple interactions	ISO	Serp1 (Mus musculus)	6480464	AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of SERP1 mRNA]	CTD	PMID:15034205
SERP1	Human	benzo[a]pyrene	increases expression	ISO	Serp1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of SERP1 mRNA	CTD	PMID:15034205
SERP1	Human	beta-lapachone	increases expression	EXP		6480464	beta-lapachone results in increased expression of SERP1 mRNA	CTD	PMID:38218311
SERP1	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Serp1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of SERP1 mRNA	CTD	PMID:19850644
SERP1	Human	bis(2-ethylhexyl) phthalate	increases expression	ISO	Serp1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of SERP1 mRNA	CTD	PMID:35550907
SERP1	Human	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Serp1 (Mus musculus)	6480464	PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of SERP1 mRNA]	CTD	PMID:19850644
SERP1	Human	bisphenol A	affects expression	ISO	Serp1 (Rattus norvegicus)	6480464	bisphenol A affects the expression of SERP1 mRNA	CTD	PMID:25181051
SERP1	Human	bisphenol A	increases expression	ISO	Serp1 (Mus musculus)	6480464	bisphenol A results in increased expression of SERP1 mRNA	CTD	PMID:32156529
SERP1	Human	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of SERP1 mRNA	CTD	PMID:30903817
SERP1	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SERP1 mRNA	CTD	PMID:35301059
SERP1	Human	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of SERP1 mRNA	CTD	PMID:38568856
SERP1	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of SERP1 mRNA	CTD	PMID:35301059
SERP1	Human	carbon nanotube	increases expression	ISO	Serp1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
SERP1	Human	celastrol	increases expression	EXP		6480464	celastrol results in increased expression of SERP1 mRNA	CTD	PMID:17010675
SERP1	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of SERP1 mRNA	CTD	PMID:19561079
SERP1	Human	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of SERP1 mRNA	CTD	PMID:27392435
SERP1	Human	clofibric acid	affects expression	ISO	Serp1 (Rattus norvegicus)	6480464	Clofibric Acid affects the expression of SERP1 mRNA	CTD	PMID:17602206
SERP1	Human	clothianidin	decreases expression	EXP		6480464	clothianidin results in decreased expression of SERP1 mRNA	CTD	PMID:31626844
SERP1	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of SERP1 mRNA	CTD	PMID:19549813
SERP1	Human	cyclosporin A	increases expression	ISO	Serp1 (Mus musculus)	6480464	Cyclosporine results in increased expression of SERP1 mRNA	CTD	PMID:19770486
SERP1	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of SERP1 mRNA	CTD	PMID:20106945 more ...
SERP1	Human	dibutyl phthalate	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Dibutyl Phthalate results in increased expression of SERP1 mRNA	CTD	PMID:21266533
SERP1	Human	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of SERP1 mRNA	CTD	PMID:35967413
SERP1	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of SERP1 mRNA	CTD	PMID:29803840
SERP1	Human	endosulfan	affects expression	ISO	Serp1 (Rattus norvegicus)	6480464	Endosulfan affects the expression of SERP1 mRNA	CTD	PMID:29391264
SERP1	Human	entinostat	increases expression	EXP		6480464	entinostat results in increased expression of SERP1 mRNA	CTD	PMID:27188386
SERP1	Human	ethanol	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Ethanol results in increased expression of SERP1 mRNA	CTD	PMID:15353170
SERP1	Human	ethanol	affects expression	ISO	Serp1 (Mus musculus)	6480464	Ethanol affects the expression of SERP1 mRNA	CTD	PMID:30319688
SERP1	Human	ethanol	affects splicing	ISO	Serp1 (Mus musculus)	6480464	Ethanol affects the splicing of SERP1 mRNA	CTD	PMID:30319688
SERP1	Human	fipronil	decreases expression	ISO	Serp1 (Rattus norvegicus)	6480464	fipronil results in decreased expression of SERP1 mRNA	CTD	PMID:34044035
SERP1	Human	folic acid	multiple interactions	ISO	Serp1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SERP1 mRNA	CTD	PMID:22206623
SERP1	Human	gedunin	increases expression	EXP		6480464	gedunin results in increased expression of SERP1 mRNA	CTD	PMID:17010675
SERP1	Human	genistein	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Genistein results in increased expression of SERP1 mRNA	CTD	PMID:17341692
SERP1	Human	genistein	increases expression	EXP		6480464	Genistein results in increased expression of SERP1 mRNA	CTD	PMID:26865667
SERP1	Human	glafenine	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Glafenine results in increased expression of SERP1 mRNA	CTD	PMID:24136188
SERP1	Human	gold atom	multiple interactions	EXP		6480464	[Polyethyleneimine binds to Gold] which results in increased expression of SERP1 mRNA	CTD	PMID:28433809
SERP1	Human	gold(0)	multiple interactions	EXP		6480464	[Polyethyleneimine binds to Gold] which results in increased expression of SERP1 mRNA	CTD	PMID:28433809
SERP1	Human	manganese atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SERP1 mRNA	CTD	PMID:39836092
SERP1	Human	manganese(0)	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SERP1 mRNA	CTD	PMID:39836092
SERP1	Human	manganese(II) chloride	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SERP1 mRNA	CTD	PMID:39836092
SERP1	Human	methapyrilene	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Methapyrilene results in increased expression of SERP1 mRNA	CTD	PMID:16393664
SERP1	Human	methidathion	decreases expression	ISO	Serp1 (Mus musculus)	6480464	methidathion results in decreased expression of SERP1 mRNA	CTD	PMID:34813904
SERP1	Human	methylmercury chloride	increases expression	EXP		6480464	methylmercuric chloride results in increased expression of SERP1 mRNA	CTD	PMID:28001369
SERP1	Human	nefazodone	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	nefazodone results in increased expression of SERP1 mRNA	CTD	PMID:24136188
SERP1	Human	nickel atom	decreases expression	EXP		6480464	Nickel results in decreased expression of SERP1 mRNA	CTD	PMID:25583101
SERP1	Human	nimesulide	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	nimesulide results in increased expression of SERP1 mRNA	CTD	PMID:24136188
SERP1	Human	nitrates	multiple interactions	ISO	Serp1 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SERP1 mRNA	CTD	PMID:35964746
SERP1	Human	oxidopamine	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Oxidopamine results in increased expression of SERP1 mRNA	CTD	PMID:12486162
SERP1	Human	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of SERP1 mRNA	CTD	PMID:35430440
SERP1	Human	paracetamol	affects expression	ISO	Serp1 (Mus musculus)	6480464	Acetaminophen affects the expression of SERP1 mRNA	CTD	PMID:17562736
SERP1	Human	paracetamol	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Acetaminophen results in increased expression of SERP1 mRNA	CTD	PMID:33387578
SERP1	Human	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SERP1 mRNA	CTD	PMID:29067470
SERP1	Human	phenobarbital	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Phenobarbital results in increased expression of SERP1 mRNA	CTD	PMID:19162173
SERP1	Human	pirinixic acid	decreases expression	ISO	Serp1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of SERP1 mRNA	CTD	PMID:23811191
SERP1	Human	pregnenolone 16alpha-carbonitrile	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Pregnenolone Carbonitrile results in increased expression of SERP1 mRNA	CTD	PMID:19162173
SERP1	Human	propiconazole	increases expression	ISO	Serp1 (Mus musculus)	6480464	propiconazole results in increased expression of SERP1 mRNA	CTD	PMID:21278054
SERP1	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of SERP1 mRNA	CTD	PMID:28595984 and PMID:34032870
SERP1	Human	sodium arsenite	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SERP1 mRNA	CTD	PMID:39836092
SERP1	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of SERP1 mRNA	CTD	PMID:38568856
SERP1	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of SERP1 mRNA	CTD	PMID:31533062
SERP1	Human	tacrolimus hydrate	increases expression	ISO	Serp1 (Mus musculus)	6480464	Tacrolimus results in increased expression of SERP1 mRNA	CTD	PMID:25270620
SERP1	Human	tamoxifen	affects expression	ISO	Serp1 (Mus musculus)	6480464	Tamoxifen affects the expression of SERP1 mRNA	CTD	PMID:17555576
SERP1	Human	tauroursodeoxycholic acid	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	ursodoxicoltaurine results in increased expression of SERP1 mRNA	CTD	PMID:15885361
SERP1	Human	testosterone	decreases expression	ISO	Serp1 (Mus musculus)	6480464	Testosterone deficiency results in decreased expression of SERP1 mRNA	CTD	PMID:33848595
SERP1	Human	tetrachloromethane	decreases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in decreased expression of SERP1 mRNA	CTD	PMID:16239168 and PMID:33387578
SERP1	Human	tetrachloromethane	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in increased expression of SERP1 mRNA	CTD	PMID:31150632
SERP1	Human	tetrachloromethane	increases expression	ISO	Serp1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of SERP1 mRNA	CTD	PMID:27339419 and PMID:31919559
SERP1	Human	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of SERP1 mRNA	CTD	PMID:22378314 and PMID:24247028
SERP1	Human	thiram	increases expression	EXP		6480464	Thiram results in increased expression of SERP1 mRNA	CTD	PMID:38568856
SERP1	Human	Tributyltin oxide	affects expression	EXP		6480464	bis(tri-n-butyltin)oxide affects the expression of SERP1 mRNA	CTD	PMID:24247028
SERP1	Human	trichloroethene	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of SERP1 mRNA	CTD	PMID:33387578
SERP1	Human	trichostatin A	increases expression	EXP		6480464	trichostatin A results in increased expression of SERP1 mRNA	CTD	PMID:24935251
SERP1	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of SERP1 mRNA	CTD	PMID:37042841
SERP1	Human	tunicamycin	increases expression	EXP		6480464	Tunicamycin results in increased expression of SERP1 mRNA	CTD	PMID:22378314 and PMID:29453283
SERP1	Human	ursodeoxycholic acid	increases expression	ISO	Serp1 (Rattus norvegicus)	6480464	Ursodeoxycholic Acid results in increased expression of SERP1 mRNA	CTD	PMID:15885361
SERP1	Human	valproic acid	decreases methylation	EXP		6480464	Valproic Acid results in decreased methylation of SERP1 gene	CTD	PMID:29154799
SERP1	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of SERP1 mRNA	CTD	PMID:23179753 and PMID:24383497
SERP1	Human	vinclozolin	affects expression	ISO	Serp1 (Rattus norvegicus)	6480464	vinclozolin affects the expression of SERP1 mRNA	CTD	PMID:19015723
SERP1	Human	vorinostat	increases expression	EXP		6480464	vorinostat results in increased expression of SERP1 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SERP1	Human	endoplasmic reticulum unfolded protein response	involved_in	IBA	CGD:CAL0000183241 more ...	150520179		GO_Central	GO_REF:0000033
SERP1	Human	endoplasmic reticulum unfolded protein response	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	glucose metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	insulin secretion	acts_upstream_of	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	muscle organ morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	plasma membrane organization	involved_in	TAS		150520179	PMID:10601334	PINC	PMID:10601334
SERP1	Human	positive regulation of growth hormone secretion	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	positive regulation of insulin secretion	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	positive regulation of organ growth	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	positive regulation of translation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	post-embryonic development	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107
SERP1	Human	protein glycosylation	involved_in	TAS		150520179	PMID:10601334	PINC	PMID:10601334
SERP1	Human	protein modification process	involved_in	TAS		150520179	PMID:10601334	PINC	PMID:10601334
SERP1	Human	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653 and UniProtKB-KW:KW-0811	150520179		UniProt	GO_REF:0000043
SERP1	Human	response to unfolded protein	involved_in	IEA	UniProtKB-KW:KW-0834	150520179		UniProt	GO_REF:0000043
SERP1	Human	skeletal system development	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z1W5 and ensembl:ENSMUSP00000029385	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SERP1	Human	cytoplasmic microtubule	located_in	IDA		150520179	PMID:23264731	UniProt	PMID:23264731
SERP1	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-9609921
SERP1	Human	endoplasmic reticulum	located_in	TAS		150520179	PMID:10601334	PINC	PMID:10601334
SERP1	Human	endoplasmic reticulum	is_active_in	IBA	CGD:CAL0000183241 and PANTHER:PTN000400928	150520179		GO_Central	GO_REF:0000033
SERP1	Human	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	150520179		UniProt	GO_REF:0000043
SERP1	Human	endoplasmic reticulum	located_in	IEA	InterPro:IPR010580	150520179		InterPro	GO_REF:0000002
SERP1	Human	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	150520179		UniProt	GO_REF:0000044
SERP1	Human	endoplasmic reticulum membrane	located_in	TAS		150520179		Reactome	Reactome:R-HSA-1791167
SERP1	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
SERP1	Human	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	150520179		UniProt	GO_REF:0000044
SERP1	Human	ribosome	located_in	TAS		150520179	PMID:10601334	PINC	PMID:10601334

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SERP1	Human	protein binding	enables	IPI	UniProtKB:Q9BSE2	150520179	PMID:25416956	IntAct	PMID:25416956
SERP1	Human	protein binding	enables	IPI	UniProtKB:A2A2Y4 more ...	150520179	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10601334	PMID:10931946	PMID:11076863	PMID:11230166	PMID:12477932	PMID:14702039	PMID:15489334	PMID:15489336	PMID:16344560	PMID:16381901	PMID:19913121	PMID:20516149
PMID:20628086	PMID:21103663	PMID:21816823	PMID:21832049	PMID:21873635	PMID:21956116	PMID:22419128	PMID:22526458	PMID:23264731	PMID:24489003	PMID:24623722	PMID:25416956
PMID:25719802	PMID:28597972	PMID:28902358	PMID:29544880	PMID:31318583	PMID:32184288	PMID:32296183	PMID:32513696	PMID:32534478	PMID:34349018	PMID:34613934	PMID:35575683
PMID:36417821	PMID:36949045	PMID:37478010

SERP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	150,541,998 - 150,546,496 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	150,541,998 - 150,603,228 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	150,259,785 - 150,264,283 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	151,742,470 - 151,747,118 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	148,672,684 - 148,677,330 (-)	NCBI		Celera
Cytogenetic Map	3	q25.1	NCBI
HuRef	3	147,633,487 - 147,638,133 (-)	NCBI		HuRef
CHM1_1	3	150,222,832 - 150,227,480 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	153,293,254 - 153,297,751 (-)	NCBI		T2T-CHM13v2.0

Serp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	58,429,390 - 58,433,305 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	58,427,238 - 58,433,313 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	58,521,969 - 58,525,884 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	58,519,817 - 58,525,892 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	58,325,891 - 58,329,806 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	58,609,907 - 58,613,683 (-)	NCBI		MGSCv36	mm8
Celera	3	58,214,581 - 58,218,497 (-)	NCBI		Celera
Cytogenetic Map	3	D	NCBI
cM Map	3	28.58	NCBI

Serp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	144,907,204 - 144,911,187 (-)	NCBI		GRCr8
mRatBN7.2	2	142,757,254 - 142,761,243 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	142,757,270 - 142,761,116 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	149,395,820 - 149,399,804 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	147,502,521 - 147,506,506 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	142,134,951 - 142,138,938 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	148,718,279 - 148,722,263 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	148,718,280 - 148,722,263 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	168,135,806 - 168,139,831 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	147,866,072 - 147,870,096 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	147,816,035 - 147,820,059 (-)	NCBI
Celera	2	137,185,924 - 137,189,868 (-)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

Serp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	1,738,242 - 1,743,107 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955448	1,738,242 - 1,742,807 (-)	NCBI	ChiLan1.0	ChiLan1.0

SERP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	148,430,669 - 148,434,849 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	148,435,911 - 148,439,579 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	147,559,607 - 147,564,668 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	155,133,115 - 155,194,354 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	155,133,115 - 155,137,241 (-)	Ensembl	panpan1.1		panPan2

SERP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	23	45,063,215 - 45,068,765 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	45,826,565 - 45,831,428 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	45,827,066 - 45,831,168 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	45,415,858 - 45,421,400 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	45,467,757 - 45,473,286 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	45,719,078 - 45,724,635 (-)	NCBI		UU_Cfam_GSD_1.0

SERP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	90,756,855 - 90,761,560 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	90,756,845 - 90,761,400 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	98,825,370 - 98,829,927 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SERP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	40,146,868 - 40,150,873 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	40,146,977 - 40,149,022 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	12,965,549 - 12,970,746 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Serp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	27,969,185 - 27,973,575 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	27,969,185 - 27,973,447 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in SERP1
3 total Variants

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
MIR1-1	hsa-miR-1	Mirtarbase	external_info	Luciferase reporter assay//Microarray	Functional MTI (WeaK)	15685193
MIR204	hsa-miR-204-5p	Mirtarbase	external_info	Luciferase reporter assay//Microarray//qRT-PCR//We	Functional MTI	21282569

Predicted Target Of

	Summary Value
Count of predictions:	2665
Count of miRNA genes:	1035
Interacting mature miRNAs:	1265
Transcripts:	ENST00000239944, ENST00000463647, ENST00000479209, ENST00000484608, ENST00000487153, ENST00000490945, ENST00000491195, ENST00000491660
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300026	BP36_H	Blood pressure QTL 36 (human)	4.04		Blood pressure	hypertension susceptibility	3	135720453	161720453	Human
1298415	BP24_H	Blood pressure QTL 24 (human)	2.9		Blood pressure	hypertension susceptibility	3	135720453	161720453	Human

G19910

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,260,445 - 150,260,553	UniSTS	GRCh37
Build 36	3	151,743,135 - 151,743,243	RGD	NCBI36
Celera	3	148,673,349 - 148,673,457	RGD
Cytogenetic Map	3	q25.1	UniSTS
HuRef	3	147,634,152 - 147,634,260	UniSTS

A002B48

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,260,445 - 150,260,553	UniSTS	GRCh37
Build 36	3	151,743,135 - 151,743,243	RGD	NCBI36
Celera	3	148,673,349 - 148,673,457	RGD
Cytogenetic Map	3	q25.1	UniSTS
HuRef	3	147,634,152 - 147,634,260	UniSTS
GeneMap99-GB4 RH Map	3	550.23	UniSTS
NCBI RH Map	3	1321.6	UniSTS

D3S2808E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,261,712 - 150,261,798	UniSTS	GRCh37
Build 36	3	151,744,402 - 151,744,488	RGD	NCBI36
Celera	3	148,674,615 - 148,674,701	RGD
Cytogenetic Map	3	q25.1	UniSTS
HuRef	3	147,635,418 - 147,635,504	UniSTS

SHGC-56912

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,260,028 - 150,260,191	UniSTS	GRCh37
Build 36	3	151,742,718 - 151,742,881	RGD	NCBI36
Celera	3	148,672,932 - 148,673,095	RGD
Cytogenetic Map	3	q25.1	UniSTS
TNG Radiation Hybrid Map	3	84770.0	UniSTS

RH15894

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,260,358 - 150,260,532	UniSTS	GRCh37
Build 36	3	151,743,048 - 151,743,222	RGD	NCBI36
Celera	3	148,673,262 - 148,673,436	RGD
Cytogenetic Map	3	q25.1	UniSTS
HuRef	3	147,634,065 - 147,634,239	UniSTS
GeneMap99-GB4 RH Map	3	548.72	UniSTS
NCBI RH Map	3	1320.4	UniSTS

D3S2837E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,260,359 - 150,260,478	UniSTS	GRCh37
Build 36	3	151,743,049 - 151,743,168	RGD	NCBI36
Celera	3	148,673,263 - 148,673,382	RGD
Cytogenetic Map	3	q25.1	UniSTS
HuRef	3	147,634,066 - 147,634,185	UniSTS
GeneMap99-GB4 RH Map	3	550.33	UniSTS
NCBI RH Map	3	1318.2	UniSTS

RH48541

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	3	150,263,313 - 150,263,453	UniSTS	GRCh37
Build 36	3	151,746,003 - 151,746,143	RGD	NCBI36
Celera	3	148,676,216 - 148,676,356	RGD
Cytogenetic Map	3	q25.1	UniSTS
HuRef	3	147,637,019 - 147,637,159	UniSTS
GeneMap99-GB4 RH Map	3	548.31	UniSTS
NCBI RH Map	3	1321.6	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4973	1726	2351	6	624	1951	465	2269	7306	6472	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_014445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA890577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB022427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC069236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC107426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF136975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK054644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK090933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK093929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK098135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK125413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL136807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC039424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC108314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC112364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC112365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR533472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB022941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ149087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X75694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000239944 ⟹ ENSP00000239944

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,541,998 - 150,546,496 (-)	Ensembl

Ensembl Acc Id:

ENST00000463647

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,566,385 - 150,583,155 (-)	Ensembl

Ensembl Acc Id:

ENST00000479209 ⟹ ENSP00000420076

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,541,998 - 150,603,174 (-)	Ensembl

Ensembl Acc Id:

ENST00000484608

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,566,799 - 150,603,168 (-)	Ensembl

Ensembl Acc Id:

ENST00000487153 ⟹ ENSP00000420002

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,544,292 - 150,546,501 (-)	Ensembl

Ensembl Acc Id:

ENST00000490945

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,565,796 - 150,603,228 (-)	Ensembl

Ensembl Acc Id:

ENST00000491195

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,546,790 - 150,603,170 (-)	Ensembl

Ensembl Acc Id:

ENST00000491660 ⟹ ENSP00000419472

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	150,545,397 - 150,546,499 (-)	Ensembl

RefSeq Acc Id:

NM_014445 ⟹ NP_055260

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	3	150,541,998 - 150,546,496 (-)	NCBI
GRCh37	3	150,259,780 - 150,264,428 (-)	RGD
Build 36	3	151,742,470 - 151,747,118 (-)	NCBI Archive
Celera	3	148,672,684 - 148,677,330 (-)	RGD
HuRef	3	147,633,487 - 147,638,133 (-)	ENTREZGENE
CHM1_1	3	150,222,832 - 150,227,480 (-)	NCBI
T2T-CHM13v2.0	3	153,293,254 - 153,297,751 (-)	NCBI

Sequence:

show sequence

AGATCGAGGCGGCGGGCTGCACATTCCCGTTGTTGCGTTGCGTTTCCTTCCTCTTTCACTCCGCGCTCACGGCGGCGGCCAAAGCGGCGGCGACGGCGGCGCGAGAACGACCCGGCGGCCAGTTCTCT
TCCTCCTGCGCACCTGCCCCGCTCGGTCAGTCAGTCGGCGGCCGGCGCCCGGCTTGTGCTCAGACCTCGCGCTTGCGGCGCCCAGGCCCAGCGGCCGTAGCTAGCGTCTGGCCTGAGAACCTCGGCGC
TCCGGCGGCGCGGGCACCACGAGCCGAGCCTCGCAGCGGCTCCAGAGGAGGCAGGCGAGTGAGCGAGTCCGAGGGGTGGCCGGGGCAGGTGGTGGCGCCGCGAAGATGGTCGCCAAGCAAAGGATCCG
TATGGCCAACGAGAAGCACAGCAAGAACATCACCCAGCGCGGCAACGTCGCCAAGACCTCGAGAAATGCCCCCGAAGAGAAGGCGTCTGTAGGACCCTGGTTATTGGCTCTCTTCATTTTTGTTGTCT
GTGGTTCTGCAATTTTCCAGATTATTCAAAGTATCAGGATGGGCATGTGAAGTGACTGACCTTAAGATGTTTCCATTCTCCTGTGAATTTTAACTTGAACTCATTCCTGATGTTTGATACCCTGGTTG
AAAACAATTCAGTAAAGCATCCTGCCTCAGAATGACTTTCCTATCATGCTTCATGTGTCATTCCAAGGTTTCTTCATGAGTCATTCCAAGTTTTCTAGTCCATACCACAGTGCCTTGCAAAAAACACC
ACATGAATAAAGCAATAAAATTTGATTGTTAAGATACAGTAGTGGACCCTACTTATTCAGTCAATTAAGAGTAAGTTTTTTTATGTGGTTATTAAAACAGTATGAACAATTAGTCTAACTCTGCATAG
ACAGGGTCTAGATTTTGTTAACCCAAATGTATAACTGCAGTTAGCTTAAATTACAATTTGAAGTCTTGTGGTTTTTATATAGCTAGGCACTTTATTACTCTTTTGAACTGAAAGCACACTCCCTTATA
GGTTCATGTAACTGTCCTGTAATAAGGTGCTTATAAATGGAACAACTACACAGCCTAGTTTTGCCACAACCTTTAGCATCTAAAAAGTTTTAAAAGCTTCTAAATGTCTAATATAAAGGGAGATGCTT
ATAGCCACAACATCTATTTTACCAATATTGTTTCCATTACACTACCTTGGATTTTGCATGAGTGAGTATAGTAACCCAAGATGCCATAAAAAAAAAACTTGATCGTTTTCTGACTTAATCAGTTACTG
TGGTTTCACTAAAAGCTACCGTGGTGGAGTGAAGTCAGTCAGGGAAGGTTTGTTTATGTTACATTTATTTCACCAGAACTATTTTAATATATCAAAGGGGTTTACTATGCCAAACAAAATTCTAGGGA
AAAATACTGCTAAAAATGGATGCCTCATCAGAACATGCTGTTGAGTCCAATGTGCCATAAGACATTTTAGCATGTTAAATAGCACTTTTAATAGCAAAAAAAGGCACATCAACTGCGAAGTTATCCTT
AGTTTGCAAATGCTTTTTCTAGATTAATGATTTTTCAATCATTAGGGTACTAGACACATCAGCCTAAAGTGGCATCTGGAATTGAATGGATTTACTGATAATGATCAGTCTTTAGTCTTCCCTTTGTT
ATATGACTTTATAGGTTATGATTGATCAAATTTACGTTTTACTAATGGTAAGGGTGAGGGTCATAGGGCAGGTTTTGGGTTTTCTAGTACTGTTGAAAACTGCAAGTATTGGCTATTTGTATACTTAG
CCATAACTTGGTGAAAAAAAACCTGAGCAGTGTCTATGTATTAATGCGTTGGAAAGAAAGCTGCTTGTGTTTGCTTTGTTAATTGCCTCAGGATATTTCTTTTAAAATAAGCTGTTTTAAGAGGAACA
GAAGGGAAATCTGCTACCTAGTCTATACACAGCGTGAACCTCACAGGGGGCTTCTGATACCCTCAAACATGGAGAACAGTAAGGGAGCAGAGTGGTTAAGGACTTTCAGGAACTTAACTATTCTGGAA
TAAGGAATGAATCAACTGACCTTGGGCCAGCAGGTTTTTAACTAAATTGTTACTTGCCTTTCTCACCCAGTTAATCAGTCTCTGTACTTGTTTCCCTTTTTGAAACAAGTGTCTTGGTTAACTAATTC
TGTTTTATGGTTGTGCTAAATTCATAGCAGGTGCCTTATTCTTTGCTTTTAGTCAAACCATTCCATATCAGAATTTTCCTTGGTTTACTATAGATATTTGGCTTTAAGTTGTTGTTTGTGTTTTTTAA
TGTACAATGTTCTGATAAATTTGACTGTTAAATTGCTATAGCTAGCAATCATTTTACATATGTAAAATTGCATTCCCTTTGTATTTCATGTGTAATTCACCAATTAAGTGCAGTTTATATTCAGGTTG
GATTATGCATGTTTAGGTAAACGAAAGCTGTGTCTTACTTGATTTATTCTTTAAAAATAAAGTTCCCTGAATATTTGATGCTTTTCTTCTAAACGGAAATGATTTTACAGTTATCTGAGTGTACCTTT
TATAGTTAGTAGAAAATGATTTTAAAGAATGTTTAGTATTGTACTTAAATGGTATGCAGAGGCACAGATGTAAGGTTTATAACTGGAAATAGGTGGTAAGAAAAATATATAGAAAGCACAATGATTTG
AATATTTTTCCACTTAGGATTTCCTAATCTCCTTGTCATCCAATTCAAGCTCAAGATGAAGCACAATTCTTTGATCTCCCTTTGCCAGTTGAATTTTATAGATCATCTAATGTTGAGCACAGTATGAG
AATAAATATTGGGGTTGTCAACATTACTCAGTTACTCTTTGTGGTTTAACTCTAACATTTCAACAAGTTGTCAATTAATTGTATCTGTTGGGTTGTATATAATGTTGCTCAAAATAATTAAGTGGACT
TCCAAAAATAAGATTTCCATTGTAACAGGATGCATTGTGATGGGCTTTGACTTACATTAAAGAAATGTGGATAGTCAA

hide sequence


Protein RefSeqs	NP_055260	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG49436	(Get FASTA)	NCBI Sequence Viewer
	AAI08315	(Get FASTA)	NCBI Sequence Viewer
	AAI12365	(Get FASTA)	NCBI Sequence Viewer
	AAI12366	(Get FASTA)	NCBI Sequence Viewer
	BAA81895	(Get FASTA)	NCBI Sequence Viewer
	CAB66741	(Get FASTA)	NCBI Sequence Viewer
	CAG38503	(Get FASTA)	NCBI Sequence Viewer
	EAW78833	(Get FASTA)	NCBI Sequence Viewer
	EAW78834	(Get FASTA)	NCBI Sequence Viewer
	EAW78835	(Get FASTA)	NCBI Sequence Viewer
	EAW78836	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000239944
	ENSP00000239944.2
	ENSP00000420076.1
GenBank Protein	Q9Y6X1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_055260 ⟸ NM_014445
- UniProtKB:	D3DNI6 (UniProtKB/Swiss-Prot), Q9Y6X1 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM hide sequence

Ensembl Acc Id:

ENSP00000420076 ⟸ ENST00000479209

Ensembl Acc Id:

ENSP00000419472 ⟸ ENST00000491660

Ensembl Acc Id:

ENSP00000420002 ⟸ ENST00000487153

Ensembl Acc Id:

ENSP00000239944 ⟸ ENST00000239944

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Y6X1-F1-model_v2	AlphaFold	Q9Y6X1	1-66	view protein structure

RGD ID:

6865986

Promoter ID:

EPDNEW_H6158

Type:

initiation region

Name:

SERP1_1

Description:

stress associated endoplasmic reticulum protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H6160

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	3	150,546,446 - 150,546,506	EPDNEW

RGD ID:

6801657

Promoter ID:

HG_KWN:46465

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

UC003EXY.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	3	151,746,906 - 151,748,067 (-)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	SERP1	COSMIC
Ensembl Genes	ENSG00000120742	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000239944	ENTREZGENE
	ENST00000239944.7	UniProtKB/Swiss-Prot
	ENST00000479209.1	UniProtKB/Swiss-Prot
GTEx	ENSG00000120742	GTEx
HGNC ID	HGNC:10759	ENTREZGENE
Human Proteome Map	SERP1	Human Proteome Map
InterPro	ER_stress-assoc	UniProtKB/Swiss-Prot
KEGG Report	hsa:27230	UniProtKB/Swiss-Prot
NCBI Gene	27230	ENTREZGENE
OMIM	617674	OMIM
PANTHER	PTHR15601	UniProtKB/Swiss-Prot
	STRESS-ASSOCIATED ENDOPLASMIC RETICULUM PROTEIN 1	UniProtKB/Swiss-Prot
Pfam	RAMP4	UniProtKB/Swiss-Prot
PharmGKB	PA162402942	PharmGKB
UniProt	C9JSB0_HUMAN	UniProtKB/TrEMBL
	C9JUH5_HUMAN	UniProtKB/TrEMBL
	D3DNI6	ENTREZGENE
	Q9Y6X1	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	D3DNI6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-16	SERP1	stress associated endoplasmic reticulum protein 1		stress-associated endoplasmic reticulum protein 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar