Advanced Search (OLGA)

Gene: ZC3H15 (zinc finger CCCH-type containing 15) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

ZC3H15

Name:

zinc finger CCCH-type containing 15

RGD ID:

1601751

HGNC Page

HGNC:29528

Description:

Enables RNA binding activity and cadherin binding activity. Involved in positive regulation of GTPase activity. Located in cytosol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DFRP1; DRG family-regulatory protein 1; HT010; LEREPO4; likely ortholog of mouse immediate early response erythropoietin 4; MSTP012; zinc finger CCCH domain-containing protein 15

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Zc3h15 (zinc finger CCCH-type containing 15)	HGNC	EggNOG, Ensembl, HGNC, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Zc3h15 (zinc finger CCCH-type containing 15)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Zc3h15 (zinc finger CCCH-type containing 15)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	ZC3H15 (zinc finger CCCH-type containing 15)	NCBI	Ortholog
Canis lupus familiaris (dog):	ZC3H15 (zinc finger CCCH-type containing 15)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zc3h15 (zinc finger CCCH-type containing 15)	NCBI	Ortholog
Sus scrofa (pig):	ZC3H15 (zinc finger CCCH-type containing 15)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	ZC3H15 (zinc finger CCCH-type containing 15)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Zc3h15 (zinc finger CCCH-type containing 15)	NCBI	Ortholog
Other homologs ²
Rattus norvegicus (Norway rat):	Zc3h15l1 (zinc finger CCCH-type containing 15 like 1)	HGNC	Ensembl, Panther
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Zc3h15 (zinc finger CCCH-type containing 15)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zc3h15 (zinc finger CCCH-type containing 15)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Zc3h15l1 (zinc finger CCCH-type containing 15 like 1)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	zc3h15 (zinc finger CCCH-type containing 15)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	F27D4.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8635	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TMA46	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	zc3h15.S	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	zc3h15	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	zc3h15.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	186,486,260 - 186,509,361 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	186,486,253 - 186,511,929 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	187,350,987 - 187,374,088 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	187,059,130 - 187,082,333 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	180,946,684 - 180,969,891 (+)	NCBI		Celera
Cytogenetic Map	2	q32.1	NCBI
HuRef	2	179,210,476 - 179,234,063 (+)	NCBI		HuRef
CHM1_1	2	187,357,183 - 187,380,391 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	186,975,546 - 186,998,651 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZC3H15	Human	Neurodevelopmental Disorders		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZC3H15	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Zc3h15 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZC3H15 mRNA	CTD	PMID:22206623
ZC3H15	Human	1,2-dimethylhydrazine	affects expression	ISO	Zc3h15 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of ZC3H15 mRNA	CTD	PMID:22206623
ZC3H15	Human	17beta-estradiol	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	Estradiol results in increased expression of ZC3H15 mRNA	CTD	PMID:39298647
ZC3H15	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Zc3h15 (Mus musculus)	6480464	AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of ZC3H15 mRNA]	CTD	PMID:15034205
ZC3H15	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin affects the expression of ZC3H15 mRNA	CTD	PMID:34747641
ZC3H15	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Zc3h15 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of ZC3H15 mRNA	CTD	PMID:21570461 and PMID:26377647
ZC3H15	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of ZC3H15 mRNA	CTD	PMID:15034205
ZC3H15	Human	2-methylcholine	affects expression	EXP		6480464	beta-methylcholine affects the expression of ZC3H15 mRNA	CTD	PMID:21179406
ZC3H15	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	bisphenol S results in increased expression of ZC3H15 mRNA	CTD	PMID:39298647
ZC3H15	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of ZC3H15 gene	CTD	PMID:27153756
ZC3H15	Human	benzo[a]pyrene	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of ZC3H15 mRNA	CTD	PMID:22228805
ZC3H15	Human	benzo[a]pyrene	decreases expression	ISO	Zc3h15 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of ZC3H15 mRNA	CTD	PMID:15034205
ZC3H15	Human	benzo[a]pyrene	multiple interactions	ISO	Zc3h15 (Mus musculus)	6480464	AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of ZC3H15 mRNA]	CTD	PMID:15034205
ZC3H15	Human	bisphenol A	increases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of ZC3H15 mRNA	CTD	PMID:25181051
ZC3H15	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ZC3H15 protein	CTD	PMID:37567409
ZC3H15	Human	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ZC3H15 mRNA and bisphenol A results in increased expression of ZC3H15 protein	CTD	PMID:33670352 and PMID:34186270
ZC3H15	Human	bisphenol A	decreases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of ZC3H15 mRNA	CTD	PMID:34947998
ZC3H15	Human	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of ZC3H15 mRNA	CTD	PMID:30903817
ZC3H15	Human	bisphenol AF	increases expression	EXP		6480464	bisphenol AF results in increased expression of ZC3H15 protein	CTD	PMID:34186270
ZC3H15	Human	Bisphenol B	increases expression	EXP		6480464	bisphenol B results in increased expression of ZC3H15 protein	CTD	PMID:34186270
ZC3H15	Human	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of ZC3H15 protein	CTD	PMID:34186270
ZC3H15	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of ZC3H15 mRNA	CTD	PMID:18560533
ZC3H15	Human	caffeine	affects phosphorylation	EXP		6480464	Caffeine affects the phosphorylation of ZC3H15 protein	CTD	PMID:35688186
ZC3H15	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of ZC3H15 mRNA	CTD	PMID:25562108
ZC3H15	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of ZC3H15 mRNA	CTD	PMID:37042841
ZC3H15	Human	dicrotophos	decreases expression	EXP		6480464	dicrotophos results in decreased expression of ZC3H15 mRNA	CTD	PMID:28302478
ZC3H15	Human	disodium selenite	increases expression	EXP		6480464	Sodium Selenite results in increased expression of ZC3H15 mRNA	CTD	PMID:18175754
ZC3H15	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of ZC3H15 mRNA	CTD	PMID:29803840
ZC3H15	Human	elemental selenium	decreases expression	EXP		6480464	Selenium results in decreased expression of ZC3H15 mRNA	CTD	PMID:19244175
ZC3H15	Human	elemental selenium	multiple interactions	EXP		6480464	[Selenium co-treated with Vitamin E] results in decreased expression of ZC3H15 mRNA	CTD	PMID:19244175
ZC3H15	Human	enzyme inhibitor	multiple interactions	EXP		6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ZC3H15 protein	CTD	PMID:23301498
ZC3H15	Human	epoxiconazole	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	epoxiconazole results in increased expression of ZC3H15 mRNA	CTD	PMID:35436446
ZC3H15	Human	ethanol	affects splicing	ISO	Zc3h15 (Mus musculus)	6480464	Ethanol affects the splicing of ZC3H15 mRNA	CTD	PMID:30319688
ZC3H15	Human	finasteride	increases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	Finasteride results in increased expression of ZC3H15 mRNA	CTD	PMID:24136188
ZC3H15	Human	flutamide	increases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	Flutamide results in increased expression of ZC3H15 mRNA	CTD	PMID:24136188
ZC3H15	Human	folic acid	multiple interactions	ISO	Zc3h15 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZC3H15 mRNA	CTD	PMID:22206623
ZC3H15	Human	folic acid	decreases expression	ISO	Zc3h15 (Mus musculus)	6480464	Folic Acid results in decreased expression of ZC3H15 mRNA	CTD	PMID:25629700
ZC3H15	Human	FR900359	increases phosphorylation	EXP		6480464	FR900359 results in increased phosphorylation of ZC3H15 protein	CTD	PMID:37730182
ZC3H15	Human	glafenine	increases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	Glafenine results in increased expression of ZC3H15 mRNA	CTD	PMID:24136188
ZC3H15	Human	gold atom	decreases expression	EXP		6480464	Gold results in decreased expression of ZC3H15 mRNA	CTD	PMID:25523186
ZC3H15	Human	gold(0)	decreases expression	EXP		6480464	Gold results in decreased expression of ZC3H15 mRNA	CTD	PMID:25523186
ZC3H15	Human	hypochlorous acid	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	Hypochlorous Acid results in increased expression of ZC3H15 mRNA	CTD	PMID:19376150
ZC3H15	Human	ivermectin	decreases expression	EXP		6480464	Ivermectin results in decreased expression of ZC3H15 protein	CTD	PMID:32959892
ZC3H15	Human	kojic acid	decreases expression	EXP		6480464	kojic acid results in decreased expression of ZC3H15 mRNA	CTD	PMID:16595896
ZC3H15	Human	methoxychlor	affects methylation	ISO	Zc3h15 (Rattus norvegicus)	6480464	Methoxychlor affects the methylation of ZC3H15 gene	CTD	PMID:35440735
ZC3H15	Human	methyl methanesulfonate	decreases expression	EXP		6480464	Methyl Methanesulfonate results in decreased expression of ZC3H15 mRNA	CTD	PMID:23649840
ZC3H15	Human	methylparaben	increases expression	EXP		6480464	methylparaben results in increased expression of ZC3H15 mRNA	CTD	PMID:31745603
ZC3H15	Human	ozone	multiple interactions	ISO	Zc3h15 (Rattus norvegicus)	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of ZC3H15 mRNA	CTD	PMID:37871705
ZC3H15	Human	perfluorooctane-1-sulfonic acid	decreases expression	EXP		6480464	perfluorooctane sulfonic acid results in decreased expression of ZC3H15 mRNA	CTD	PMID:27153767
ZC3H15	Human	perfluorooctanoic acid	decreases expression	EXP		6480464	perfluorooctanoic acid results in decreased expression of ZC3H15 protein	CTD	PMID:26879310
ZC3H15	Human	rotenone	decreases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	Rotenone results in decreased expression of ZC3H15 protein	CTD	PMID:35544339
ZC3H15	Human	SB 431542	multiple interactions	EXP		6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of ZC3H15 protein	CTD	PMID:37664457
ZC3H15	Human	selenium atom	decreases expression	EXP		6480464	Selenium results in decreased expression of ZC3H15 mRNA	CTD	PMID:19244175
ZC3H15	Human	selenium atom	multiple interactions	EXP		6480464	[Selenium co-treated with Vitamin E] results in decreased expression of ZC3H15 mRNA	CTD	PMID:19244175
ZC3H15	Human	sodium arsenite	multiple interactions	EXP		6480464	sodium arsenite results in decreased expression of and results in increased activity of ZC3H15 protein	CTD	PMID:30528433
ZC3H15	Human	succimer	multiple interactions	ISO	Zc3h15 (Mus musculus)	6480464	[Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of ZC3H15 mRNA	CTD	PMID:26378955
ZC3H15	Human	tetrachloromethane	increases expression	ISO	Zc3h15 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of ZC3H15 mRNA	CTD	PMID:27339419 and PMID:31919559
ZC3H15	Human	thioacetamide	increases expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of ZC3H15 mRNA	CTD	PMID:34492290
ZC3H15	Human	titanium dioxide	decreases methylation	ISO	Zc3h15 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of ZC3H15 promoter	CTD	PMID:35295148
ZC3H15	Human	triphenyl phosphate	affects expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	triphenyl phosphate affects the expression of ZC3H15 mRNA	CTD	PMID:30589522
ZC3H15	Human	triptonide	affects expression	ISO	Zc3h15 (Mus musculus)	6480464	triptonide affects the expression of ZC3H15 mRNA	CTD	PMID:33045310
ZC3H15	Human	vinclozolin	affects expression	ISO	Zc3h15 (Rattus norvegicus)	6480464	vinclozolin affects the expression of ZC3H15 mRNA	CTD	PMID:19015723
ZC3H15	Human	vitamin E	decreases expression	EXP		6480464	Vitamin E results in decreased expression of ZC3H15 mRNA	CTD	PMID:19244175
ZC3H15	Human	vitamin E	multiple interactions	EXP		6480464	[Selenium co-treated with Vitamin E] results in decreased expression of ZC3H15 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZC3H15	Human	cytokine-mediated signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:Q3TIV5 and ensembl:ENSMUSP00000080301	150520179		Ensembl	GO_REF:0000107
ZC3H15	Human	cytoplasmic translation	involved_in	IBA	PANTHER:PTN000293621 and SGD:S000005617	150520179		GO_Central	GO_REF:0000033
ZC3H15	Human	positive regulation of GTPase activity	involved_in	IDA		150520179	PMID:23711155	UniProt	PMID:23711155

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZC3H15	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
ZC3H15	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
ZC3H15	Human	cytosol	located_in	IDA		150520179		HPA	GO_REF:0000052
ZC3H15	Human	cytosol	is_active_in	IBA	PANTHER:PTN000293621 and UniProtKB:Q8WU90	150520179		GO_Central	GO_REF:0000033
ZC3H15	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-9629591
ZC3H15	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
ZC3H15	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZC3H15	Human	cadherin binding	enables	HDA		150520179	PMID:25468996	BHF-UCL	PMID:25468996
ZC3H15	Human	metal ion binding	enables	IEA	InterPro:IPR000571 and InterPro:IPR036855	150520179		InterPro	GO_REF:0000002
ZC3H15	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
ZC3H15	Human	protein binding	enables	IPI	UniProtKB:Q9Y295	150520179	PMID:19819225 more ...	IntAct	PMID:19819225 more ...
ZC3H15	Human	RNA binding	enables	HDA		150520179	PMID:22658674 and PMID:22681889	UniProt	PMID:22658674 and PMID:22681889
ZC3H15	Human	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	150520179		UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10880228	PMID:12477932	PMID:14702039	PMID:15676025	PMID:16009940	PMID:17207965	PMID:18029348	PMID:19274049	PMID:19490893	PMID:19819225	PMID:20925576	PMID:21516116
PMID:21873635	PMID:21900206	PMID:22113938	PMID:22658674	PMID:22681889	PMID:22939629	PMID:23125841	PMID:23455922	PMID:23624947	PMID:23711155	PMID:24244333	PMID:24457600
PMID:25281560	PMID:25416956	PMID:25468996	PMID:25921289	PMID:26186194	PMID:26344197	PMID:26496610	PMID:26638075	PMID:26673895	PMID:27049334	PMID:27142060	PMID:27191988
PMID:28416769	PMID:28514442	PMID:28515276	PMID:28712289	PMID:29229926	PMID:29509190	PMID:29568061	PMID:29802200	PMID:29845934	PMID:29872149	PMID:30631154	PMID:30884312
PMID:30940648	PMID:30948266	PMID:31059266	PMID:31091453	PMID:31527615	PMID:31665637	PMID:31753913	PMID:32129710	PMID:32296183	PMID:32457219	PMID:32687490	PMID:32707033
PMID:32788342	PMID:32807901	PMID:32838362	PMID:32994395	PMID:33022573	PMID:33306668	PMID:33397691	PMID:33545068	PMID:33916271	PMID:33957083	PMID:33961781	PMID:34029587
PMID:34079125	PMID:34189442	PMID:34349018	PMID:34591612	PMID:34597346	PMID:34709727	PMID:34988227	PMID:35013218	PMID:35027542	PMID:35256949	PMID:35271311	PMID:35439318
PMID:35509820	PMID:35563538	PMID:35652658	PMID:35688132	PMID:35831314	PMID:35944360	PMID:36057605	PMID:36114006	PMID:36215168	PMID:36232890	PMID:36373674	PMID:36526897
PMID:36897256	PMID:37314180	PMID:37774976	PMID:38113892	PMID:38697112	PMID:38891874	PMID:39231216

ZC3H15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	186,486,260 - 186,509,361 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	186,486,253 - 186,511,929 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	187,350,987 - 187,374,088 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	187,059,130 - 187,082,333 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	180,946,684 - 180,969,891 (+)	NCBI		Celera
Cytogenetic Map	2	q32.1	NCBI
HuRef	2	179,210,476 - 179,234,063 (+)	NCBI		HuRef
CHM1_1	2	187,357,183 - 187,380,391 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	186,975,546 - 186,998,651 (+)	NCBI		T2T-CHM13v2.0

Zc3h15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	83,474,922 - 83,494,961 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	83,474,779 - 83,494,966 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	83,644,578 - 83,664,617 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	83,644,435 - 83,664,622 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	83,484,735 - 83,504,774 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	83,445,417 - 83,465,456 (+)	NCBI		MGSCv36	mm8
Celera	2	85,284,428 - 85,304,248 (+)	NCBI		Celera
Cytogenetic Map	2	D	NCBI
cM Map	2	49.33	NCBI

Zc3h15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	89,151,432 - 89,171,203 (+)	NCBI		GRCr8
mRatBN7.2	3	68,744,591 - 68,764,335 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	68,744,604 - 68,764,333 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	72,147,117 - 72,166,722 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	80,745,773 - 80,765,378 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	78,480,214 - 78,499,776 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	71,020,420 - 71,040,159 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	71,020,534 - 71,040,157 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	77,550,822 - 77,570,544 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	66,821,085 - 66,840,710 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	66,717,456 - 66,737,080 (+)	NCBI
Celera	3	68,123,487 - 68,143,111 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

Zc3h15
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	11,740,107 - 11,761,005 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	11,740,107 - 11,761,005 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZC3H15
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	89,161,727 - 89,185,225 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	89,176,974 - 89,200,205 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	73,774,955 - 73,798,061 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	191,576,403 - 191,599,609 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	191,576,403 - 191,599,609 (+)	Ensembl	panpan1.1		panPan2

ZC3H15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	28,730,213 - 28,743,884 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	28,725,079 - 28,743,884 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	28,627,635 - 28,641,296 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	28,950,239 - 29,009,303 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	28,949,771 - 28,969,725 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	29,014,656 - 29,028,335 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	28,946,032 - 28,959,704 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	29,116,356 - 29,130,029 (+)	NCBI		UU_Cfam_GSD_1.0

Zc3h15
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	145,903,340 - 145,929,725 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936506	10,907,697 - 10,934,785 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936506	10,908,347 - 10,934,785 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZC3H15
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	91,493,713 - 91,518,760 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	91,493,591 - 91,517,362 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	101,503,541 - 101,527,322 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZC3H15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	72,020,594 - 72,044,050 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	72,020,808 - 72,043,420 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	127,461,984 - 127,485,862 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zc3h15
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624899	3,394,009 - 3,415,446 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in ZC3H15
20 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 2q31.1-33.2(chr2:174898848-203941548)x1	copy number loss	See cases [RCV000050980]	Chr2:174898848..203941548 [GRCh38] Chr2:175763576..204806271 [GRCh37] Chr2:175471822..204514516 [NCBI36] Chr2:2q31.1-33.2	pathogenic
GRCh38/hg38 2q31.1-33.1(chr2:176304445-202039790)x1	copy number loss	See cases [RCV000052558]	Chr2:176304445..202039790 [GRCh38] Chr2:177169173..202904513 [GRCh37] Chr2:176877419..202612758 [NCBI36] Chr2:2q31.1-33.1	pathogenic
GRCh38/hg38 2q31.2-33.1(chr2:177874070-198525492)x1	copy number loss	See cases [RCV000052559]	Chr2:177874070..198525492 [GRCh38] Chr2:178738797..199390216 [GRCh37] Chr2:178447043..199098461 [NCBI36] Chr2:2q31.2-33.1	pathogenic
NM_018471.2(ZC3H15):c.513G>A (p.Lys171=)	single nucleotide variant	Malignant melanoma [RCV000060425]	Chr2:186502566 [GRCh38] Chr2:187367293 [GRCh37] Chr2:187075538 [NCBI36] Chr2:2q32.1	not provided
GRCh38/hg38 2q32.1-33.1(chr2:186027472-201059372)x1	copy number loss	See cases [RCV000135876]	Chr2:186027472..201059372 [GRCh38] Chr2:186892199..201924095 [GRCh37] Chr2:186600444..201632340 [NCBI36] Chr2:2q32.1-33.1	pathogenic
GRCh38/hg38 2q31.1-32.2(chr2:171429233-189179568)x1	copy number loss	See cases [RCV000136850]	Chr2:171429233..189179568 [GRCh38] Chr2:172285743..190044294 [GRCh37] Chr2:171993989..189752539 [NCBI36] Chr2:2q31.1-32.2	pathogenic
GRCh38/hg38 2q31.1-32.2(chr2:174634502-189000964)x1	copy number loss	See cases [RCV000136861]	Chr2:174634502..189000964 [GRCh38] Chr2:175499230..189865690 [GRCh37] Chr2:175207476..189573935 [NCBI36] Chr2:2q31.1-32.2	pathogenic
GRCh38/hg38 2q31.3-32.1(chr2:180942902-187372388)x1	copy number loss	See cases [RCV000137116]	Chr2:180942902..187372388 [GRCh38] Chr2:181807629..188237115 [GRCh37] Chr2:181515874..187945360 [NCBI36] Chr2:2q31.3-32.1	pathogenic
GRCh38/hg38 2q31.3-32.3(chr2:181758701-192015392)x1	copy number loss	See cases [RCV000138253]	Chr2:181758701..192015392 [GRCh38] Chr2:182623428..192880118 [GRCh37] Chr2:182331673..192588363 [NCBI36] Chr2:2q31.3-32.3	pathogenic
GRCh38/hg38 2q31.3-36.2(chr2:180513793-224302848)x3	copy number gain	See cases [RCV000139446]	Chr2:180513793..224302848 [GRCh38] Chr2:181378520..225167565 [GRCh37] Chr2:181086765..224875809 [NCBI36] Chr2:2q31.3-36.2	pathogenic
GRCh38/hg38 2q31.2-32.3(chr2:177827730-195125329)x1	copy number loss	See cases [RCV000141735]	Chr2:177827730..195125329 [GRCh38] Chr2:178692457..195990053 [GRCh37] Chr2:178400703..195698298 [NCBI36] Chr2:2q31.2-32.3	pathogenic
GRCh38/hg38 2q31.1-32.3(chr2:176086763-193201970)x1	copy number loss	See cases [RCV000143484]	Chr2:176086763..193201970 [GRCh38] Chr2:176951491..194066696 [GRCh37] Chr2:176659737..193774941 [NCBI36] Chr2:2q31.1-32.3	pathogenic
GRCh37/hg19 2q31.1-32.3(chr2:177315153-196375520)x1	copy number loss	See cases [RCV000239432]	Chr2:177315153..196375520 [GRCh37] Chr2:2q31.1-32.3	pathogenic
GRCh37/hg19 2q31.1-35(chr2:169829974-215521436)x3	copy number gain	See cases [RCV000448271]	Chr2:169829974..215521436 [GRCh37] Chr2:2q31.1-35	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:12771-242783384)	copy number gain	See cases [RCV000512056]	Chr2:12771..242783384 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:12771-242783384)x3	copy number gain	See cases [RCV000511212]	Chr2:12771..242783384 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:14238-243048760)x3	copy number gain	not provided [RCV000752802]	Chr2:14238..243048760 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:15672-243101834)x3	copy number gain	not provided [RCV000752804]	Chr2:15672..243101834 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
GRCh37/hg19 2q32.1(chr2:187370142-188535099)x4	copy number gain	not provided [RCV000740779]	Chr2:187370142..188535099 [GRCh37] Chr2:2q32.1	uncertain significance
GRCh37/hg19 2q31.1-32.3(chr2:174690039-195521582)x1	copy number loss	not provided [RCV001005359]	Chr2:174690039..195521582 [GRCh37] Chr2:2q31.1-32.3	pathogenic
Single allele	deletion	Neurodevelopmental disorder [RCV000787402]	Chr2:186356601..188906835 [GRCh37] Chr2:2q32.1	pathogenic
GRCh37/hg19 2q32.1(chr2:186861444-188658263)x1	copy number loss	not provided [RCV000845864]	Chr2:186861444..188658263 [GRCh37] Chr2:2q32.1	uncertain significance
GRCh37/hg19 2q24.3-32.3(chr2:167329586-192756373)x1	copy number loss	not provided [RCV000848216]	Chr2:167329586..192756373 [GRCh37] Chr2:2q24.3-32.3	pathogenic
GRCh37/hg19 2q24.2-34(chr2:163233162-211927188)x3	copy number gain	not provided [RCV001005349]	Chr2:163233162..211927188 [GRCh37] Chr2:2q24.2-34	pathogenic
GRCh37/hg19 2q32.1(chr2:186234826-188972311)x3	copy number gain	not provided [RCV000847709]	Chr2:186234826..188972311 [GRCh37] Chr2:2q32.1	uncertain significance
GRCh37/hg19 2q32.1(chr2:183764930-187399282)x1	copy number loss	not provided [RCV001249408]	Chr2:183764930..187399282 [GRCh37] Chr2:2q32.1	not provided
GRCh37/hg19 2q32.1-34(chr2:185697659-213002074)	copy number loss	Chromosome 2q32-q33 deletion syndrome [RCV002280608]	Chr2:185697659..213002074 [GRCh37] Chr2:2q32.1-34	pathogenic
GRCh37/hg19 2q31.2-37.3(chr2:178397959-243007457)x3	copy number gain	See cases [RCV001263052]	Chr2:178397959..243007457 [GRCh37] Chr2:2q31.2-37.3	pathogenic
GRCh37/hg19 2p25.3-q37.3(chr2:1-243199373)	copy number gain	Mosaic trisomy 2 [RCV002280628]	Chr2:1..243199373 [GRCh37] Chr2:2p25.3-q37.3	pathogenic
NM_018471.3(ZC3H15):c.1012A>C (p.Ile338Leu)	single nucleotide variant	not specified [RCV004686082]	Chr2:186506758 [GRCh38] Chr2:187371485 [GRCh37] Chr2:2q32.1	uncertain significance
GRCh37/hg19 2q31.1-35(chr2:169829974-215521436)	copy number gain	not specified [RCV002053265]	Chr2:169829974..215521436 [GRCh37] Chr2:2q31.1-35	pathogenic
GRCh37/hg19 2q32.1-33.1(chr2:187152754-199960525)x1	copy number loss	not provided [RCV002472632]	Chr2:187152754..199960525 [GRCh37] Chr2:2q32.1-33.1	pathogenic
NM_018471.3(ZC3H15):c.893G>A (p.Arg298His)	single nucleotide variant	not specified [RCV004092560]	Chr2:186505768 [GRCh38] Chr2:187370495 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.439A>G (p.Lys147Glu)	single nucleotide variant	not specified [RCV004079402]	Chr2:186501422 [GRCh38] Chr2:187366149 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.351T>G (p.Asp117Glu)	single nucleotide variant	not specified [RCV004127842]	Chr2:186501334 [GRCh38] Chr2:187366061 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.169C>G (p.Pro57Ala)	single nucleotide variant	not specified [RCV004218243]	Chr2:186495326 [GRCh38] Chr2:187360053 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.847G>A (p.Ala283Thr)	single nucleotide variant	not specified [RCV004175703]	Chr2:186505580 [GRCh38] Chr2:187370307 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.131A>G (p.Lys44Arg)	single nucleotide variant	not specified [RCV004245140]	Chr2:186495288 [GRCh38] Chr2:187360015 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.646G>T (p.Val216Leu)	single nucleotide variant	not specified [RCV004199070]	Chr2:186504143 [GRCh38] Chr2:187368870 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.637C>G (p.Pro213Ala)	single nucleotide variant	not specified [RCV004187589]	Chr2:186504134 [GRCh38] Chr2:187368861 [GRCh37] Chr2:2q32.1	uncertain significance
GRCh37/hg19 2q32.1-36.1(chr2:186698504-223918111)x3	copy number gain	See cases [RCV003329558]	Chr2:186698504..223918111 [GRCh37] Chr2:2q32.1-36.1	pathogenic
GRCh37/hg19 2q32.1(chr2:186712840-187407719)x3	copy number gain	not provided [RCV003484081]	Chr2:186712840..187407719 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.1162G>A (p.Glu388Lys)	single nucleotide variant	not specified [RCV004481265]	Chr2:186508614 [GRCh38] Chr2:187373341 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.1175C>T (p.Thr392Met)	single nucleotide variant	not specified [RCV004481266]	Chr2:186508627 [GRCh38] Chr2:187373354 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.1234T>A (p.Leu412Met)	single nucleotide variant	not specified [RCV004481267]	Chr2:186508686 [GRCh38] Chr2:187373413 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.660T>A (p.Asp220Glu)	single nucleotide variant	not specified [RCV004481268]	Chr2:186504157 [GRCh38] Chr2:187368884 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.950G>A (p.Gly317Glu)	single nucleotide variant	not specified [RCV004686081]	Chr2:186505825 [GRCh38] Chr2:187370552 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.1062A>T (p.Arg354Ser)	single nucleotide variant	not specified [RCV004686083]	Chr2:186506808 [GRCh38] Chr2:187371535 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.801T>G (p.Ile267Met)	single nucleotide variant	not specified [RCV004885060]	Chr2:186505534 [GRCh38] Chr2:187370261 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.863T>C (p.Val288Ala)	single nucleotide variant	not specified [RCV004885062]	Chr2:186505596 [GRCh38] Chr2:187370323 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.67A>T (p.Ile23Phe)	single nucleotide variant	not specified [RCV004885061]	Chr2:186486449 [GRCh38] Chr2:187351176 [GRCh37] Chr2:2q32.1	uncertain significance
NM_018471.3(ZC3H15):c.687A>T (p.Glu229Asp)	single nucleotide variant	not specified [RCV004893104]	Chr2:186504184 [GRCh38] Chr2:187368911 [GRCh37] Chr2:2q32.1	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	1542
Count of miRNA genes:	643
Interacting mature miRNAs:	759
Transcripts:	ENST00000337859, ENST00000421536, ENST00000437396, ENST00000445547, ENST00000468120, ENST00000477672, ENST00000481101, ENST00000496289, ENST00000498757, ENST00000544130
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

RH121216

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	187,349,155 - 187,349,442	UniSTS	GRCh37
Build 36	2	187,057,400 - 187,057,687	RGD	NCBI36
Celera	2	180,944,954 - 180,945,241	RGD
Cytogenetic Map	2	q32.1	UniSTS
HuRef	2	179,208,747 - 179,209,034	UniSTS
TNG Radiation Hybrid Map	2	103255.0	UniSTS

RH70209

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	187,368,614 - 187,368,782	UniSTS	GRCh37
Build 36	2	187,076,859 - 187,077,027	RGD	NCBI36
Celera	2	180,964,416 - 180,964,584	RGD
Cytogenetic Map	2	q32.1	UniSTS
HuRef	2	179,228,588 - 179,228,756	UniSTS
GeneMap99-GB4 RH Map	2	593.65	UniSTS

A009S24

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	187,368,677 - 187,368,803	UniSTS	GRCh37
Build 36	2	187,076,922 - 187,077,048	RGD	NCBI36
Celera	2	180,964,479 - 180,964,605	RGD
Cytogenetic Map	2	q32.1	UniSTS
HuRef	2	179,228,651 - 179,228,777	UniSTS
GeneMap99-GB4 RH Map	2	593.65	UniSTS

T16069

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	187,373,702 - 187,374,013	UniSTS	GRCh37
Build 36	2	187,081,947 - 187,082,258	RGD	NCBI36
Celera	2	180,969,505 - 180,969,816	RGD
Cytogenetic Map	2	q32.1	UniSTS
HuRef	2	179,233,677 - 179,233,988	UniSTS
Whitehead-YAC Contig Map	2		UniSTS

G32811

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	2	187,368,677 - 187,368,803	UniSTS	GRCh37
Celera	2	180,964,479 - 180,964,605	UniSTS
Cytogenetic Map	2	q32.1	UniSTS
HuRef	2	179,228,651 - 179,228,777	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4974	1726	2351	6	624	1951	465	2270	7306	6472	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_018471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017004502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC018867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF109366	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF147724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF161421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF220184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF289586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF462448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK001901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK297658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK298615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL040058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL049948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC012336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC021102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000337859 ⟹ ENSP00000338788

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,260 - 186,509,361 (+)	Ensembl

Ensembl Acc Id:

ENST00000421536 ⟹ ENSP00000410981

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,253 - 186,506,091 (+)	Ensembl

Ensembl Acc Id:

ENST00000437396 ⟹ ENSP00000407192

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,263 - 186,501,375 (+)	Ensembl

Ensembl Acc Id:

ENST00000445547 ⟹ ENSP00000415788

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,506,713 - 186,509,114 (+)	Ensembl

Ensembl Acc Id:

ENST00000468120

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,918 - 186,504,099 (+)	Ensembl

Ensembl Acc Id:

ENST00000477672

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,267 - 186,495,319 (+)	Ensembl

Ensembl Acc Id:

ENST00000481101

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,891 - 186,504,086 (+)	Ensembl

Ensembl Acc Id:

ENST00000496289

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,487,270 - 186,504,070 (+)	Ensembl

Ensembl Acc Id:

ENST00000498757

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,505,091 - 186,508,690 (+)	Ensembl

Ensembl Acc Id:

ENST00000718440 ⟹ ENSP00000520825

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	2	186,486,260 - 186,511,929 (+)	Ensembl

RefSeq Acc Id:

NM_018471 ⟹ NP_060941

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	2	186,486,260 - 186,509,361 (+)	NCBI
GRCh37	2	187,350,885 - 187,374,088 (+)	RGD
Build 36	2	187,059,130 - 187,082,333 (+)	NCBI Archive
Celera	2	180,946,684 - 180,969,891 (+)	RGD
HuRef	2	179,210,476 - 179,234,063 (+)	RGD
CHM1_1	2	187,357,183 - 187,380,391 (+)	NCBI
T2T-CHM13v2.0	2	186,975,546 - 186,998,651 (+)	NCBI

Sequence:

show sequence

GACTCGCTTTCCGTGCGGTGCGGCGAGTGAGGCCCCGGTCTTCCTCCTCGTCCTGCCGCAGGGCCAGAACCCCTGACGGTATTCAGCTGCGCGTAAGTCTGGCCGGTGCCATCTGTCTCCGCAATGCC
CCCCAAGAAACAGGCTCAGGCCGGGGGCAGCAAAAAGGCGGAGCAAAAAAAGAAGGAGAAGATTATCGAAGACAAAACTTTCGGTTTGAAGAATAAGAAAGGAGCAAAGCAACAGAAGTTTATCAAGG
CTGTCACACATCAAGTTAAATTTGGTCAACAAAATCCACGTCAGGTAGCACAGAGTGAAGCTGAAAAGAAATTGAAGAAGGATGACAAGAAGAAAGAATTGCAGGAGCTAAATGAGCTGTTCAAACCT
GTAGTTGCTGCTCAAAAAATAAGTAAAGGTGCAGATCCCAAGTCTGTAGTATGTGCATTCTTCAAGCAAGGACAGTGTACTAAAGGAGATAAGTGTAAGTTCTCCCATGACTTGACTCTGGAGAGAAA
ATGTGAAAAGCGAAGTGTTTACATTGATGCAAGAGATGAAGAACTTGAAAAAGATACTATGGATAATTGGGATGAGAAAAAGCTGGAAGAAGTAGTGAACAAGAAGCACGGTGAGGCGGAAAAGAAAA
AACCAAAAACTCAAATAGTGTGCAAGCATTTCCTGGAAGCTATTGAAAACAACAAGTATGGCTGGTTTTGGGTATGCCCTGGAGGGGGTGATATTTGCATGTATCGTCATGCACTTCCTCCTGGATTT
GTGTTGAAAAAAGATAAAAAGAAAGAAGAGAAAGAAGATGAAATTTCATTAGAAGATCTAATTGAGAGAGAGCGTTCTGCCCTAGGTCCAAATGTTACCAAAATCACTCTAGAATCTTTTCTTGCCTG
GAAGAAAAGGAAAAGACAAGAAAAGATTGATAAACTTGAACAAGATATGGAAAGAAGGAAAGCTGACTTCAAAGCAGGGAAAGCACTAGTGATCAGTGGTCGTGAAGTGTTTGAATTTCGTCCTGAAC
TGGTCAATGATGATGATGAGGAAGCAGATGATACCCGCTACACCCAGGGAACAGGTGGTGATGAGGTTGATGATTCAGTGAGTGTAAATGACATAGATTTAAGCCTGTACATCCCAAGAGATGTAGAT
GAAACAGGTATTACTGTAGCCAGTCTTGAAAGATTCAGCACATATACTTCAGATAAAGATGAAAACAAATTAAGTGAAGCTTCTGGAGGTAGGGCTGAAAATGGTGAAAGAAGTGACTTGGAAGAGGA
CAACGAGAGGGAGGGAACGGAAAATGGAGCCATTGATGCTGTTCCTGTTGATGAAAATCTTTTCACTGGAGAGGATTTGGATGAACTAGAAGAAGAATTAAATACACTTGATTTAGAAGAATGACACC
AAACACATCGCTGAAAAAATTAAGTCAGCTCAGCACGAGTTGAAATTGACTACATTAATTTCTTTCCACCTAGAATCAACAGGATGTTTATTTCCTATGCTGATTCTGGAGGAGTTAACCTCCTGCAA
AAAAGGCATCTTGTCCCTACATCTTCTCTTCTGACTTTGGCTACATCTCATAGTAAGTTCAGAGTAGTTCATGATAAATTGAAAATATAATGGTCATTGCAGAAAATGATTGATGTTGTAACTGTCCA
CCCAAGTAAGAAGTGTATCTGCCTTTCCATCTTTTGGTTTTCATTTGGGCATGTGCTATTACCAGAAACAACAAACTTATATTTAAAATACCCTTCATTTGACACAGTTTTTAATGAGTGATTTAATT
TCCTCTGTATTTGTATGTTTAGAAGACTGCCTAAAACATGAGCACTGTACTTCATAAAGGAAACTGCGTATGCAGATTCAGTATTGTGTATCTTTGGACAATTAGATGGACATTTAAAATGGAACTTC
TTTTATCTGACAGGATCAGCTACAATGCCCTGTGTTAAATTGTTTAAAAGTTTCCCTTTTCTTTTTTGCCAATAAAGTTGTAAATAAAGACCATCATACATTAAAATCCAAA

hide sequence


Protein RefSeqs	NP_060941	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF28981	(Get FASTA)	NCBI Sequence Viewer
	AAF67649	(Get FASTA)	NCBI Sequence Viewer
	AAH21102	(Get FASTA)	NCBI Sequence Viewer
	AAL55770	(Get FASTA)	NCBI Sequence Viewer
	AAQ13514	(Get FASTA)	NCBI Sequence Viewer
	AAX88885	(Get FASTA)	NCBI Sequence Viewer
	BAA91968	(Get FASTA)	NCBI Sequence Viewer
	BAG60024	(Get FASTA)	NCBI Sequence Viewer
	BAH12828	(Get FASTA)	NCBI Sequence Viewer
	EAX10935	(Get FASTA)	NCBI Sequence Viewer
	EAX10936	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000338788
	ENSP00000338788.6
GenBank Protein	Q8WU90	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_060941 ⟸ NM_018471

- UniProtKB:

Q9NZ37 (UniProtKB/Swiss-Prot), Q9NUZ3 (UniProtKB/Swiss-Prot), Q8WZ06 (UniProtKB/Swiss-Prot), Q5QTQ4 (UniProtKB/Swiss-Prot), D3DPG7 (UniProtKB/Swiss-Prot), B4DMW2 (UniProtKB/Swiss-Prot), Q9P079 (UniProtKB/Swiss-Prot), Q8WU90 (UniProtKB/Swiss-Prot), B7Z592 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQVAQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCKFSHDLTLE
RKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGEAEKKKPKTQIVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITLESFL
AWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIPRDVDETGITVASLERFSTYTSDKDENKLSEASGGRAENGERSDLE
EDNEREGTENGAIDAVPVDENLFTGEDLDELEEELNTLDLEE

hide sequence

Ensembl Acc Id:

ENSP00000338788 ⟸ ENST00000337859

Ensembl Acc Id:

ENSP00000415788 ⟸ ENST00000445547

Ensembl Acc Id:

ENSP00000410981 ⟸ ENST00000421536

Ensembl Acc Id:

ENSP00000407192 ⟸ ENST00000437396

Protein Domains

C3H1-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8WU90-F1-model_v2	AlphaFold	Q8WU90	1-426	view protein structure

RGD ID:

6862274

Promoter ID:

EPDNEW_H4302

Type:

initiation region

Name:

ZC3H15_1

Description:

zinc finger CCCH-type containing 15

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	2	186,486,260 - 186,486,320	EPDNEW

RGD ID:

6798482

Promoter ID:

HG_KWN:36281

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000334547, OTTHUMT00000334548, OTTHUMT00000334549, OTTHUMT00000334550, OTTHUMT00000334551, OTTHUMT00000334552, OTTHUMT00000334553

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	2	187,059,031 - 187,060,147 (+)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	ZC3H15	COSMIC
Ensembl Genes	ENSG00000065548	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000337859	ENTREZGENE
	ENST00000337859.11	UniProtKB/Swiss-Prot
Gene3D-CATH	6.20.400.10	UniProtKB/Swiss-Prot
	Zinc finger, CCCH-type	UniProtKB/Swiss-Prot
GTEx	ENSG00000065548	GTEx
HGNC ID	HGNC:29528	ENTREZGENE
Human Proteome Map	ZC3H15	Human Proteome Map
InterPro	ZC3H15/TMA46_C	UniProtKB/Swiss-Prot
	Znf_CCCH	UniProtKB/Swiss-Prot
	Znf_CCCH_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:55854	UniProtKB/Swiss-Prot
NCBI Gene	55854	ENTREZGENE
OMIM	619704	OMIM
PANTHER	ZINC FINGER CCCH DOMAIN-CONTAINING PROTEIN 15	UniProtKB/Swiss-Prot
	ZINC FINGER-CONTAINING PROTEIN P48ZNF	UniProtKB/Swiss-Prot
Pfam	DFRP_C	UniProtKB/Swiss-Prot
	zf-CCCH	UniProtKB/Swiss-Prot
PharmGKB	PA162409508	PharmGKB
PROSITE	ZF_C3H1	UniProtKB/Swiss-Prot
SMART	ZnF_C3H1	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF90229	UniProtKB/Swiss-Prot
UniProt	B4DMW2	ENTREZGENE
	B7Z592	ENTREZGENE, UniProtKB/TrEMBL
	D3DPG7	ENTREZGENE
	F8WB26_HUMAN	UniProtKB/TrEMBL
	F8WF67_HUMAN	UniProtKB/TrEMBL
	H7C466_HUMAN	UniProtKB/TrEMBL
	Q5QTQ4	ENTREZGENE
	Q8WU90	ENTREZGENE
	Q8WZ06	ENTREZGENE
	Q9NUZ3	ENTREZGENE
	Q9NZ37	ENTREZGENE
	Q9P079	ENTREZGENE
	ZC3HF_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	B4DMW2	UniProtKB/Swiss-Prot
	D3DPG7	UniProtKB/Swiss-Prot
	Q5QTQ4	UniProtKB/Swiss-Prot
	Q8WZ06	UniProtKB/Swiss-Prot
	Q9NUZ3	UniProtKB/Swiss-Prot
	Q9NZ37	UniProtKB/Swiss-Prot
	Q9P079	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar