Advanced Search (OLGA)

Gene: Il36g (interleukin 36, gamma) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Il36g

Name:

interleukin 36, gamma

RGD ID:

1563019

Description:

Predicted to enable cytokine activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; cytokine-mediated signaling pathway; and inflammatory response. Predicted to act upstream of or within negative regulation of myoblast differentiation; negative regulation of myoblast fusion; and positive regulation of interleukin-6 production. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be active in extracellular space. Orthologous to human IL36G (interleukin 36 gamma); INTERACTS WITH bisphenol A; paracetamol; sodium fluoride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Il1f9; interleukin 1 family, member 9; interleukin-1 family member 9; interleukin-36 gamma; LOC499744; RGD1563019; similar to IL-1F9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL36G (interleukin 36 gamma)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Il36g (interleukin 36G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL36G (interleukin 36 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL36G (interleukin 36 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il36g (interleukin 36 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL36G (interleukin 36 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il36g (interleukin 36 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IL36A (interleukin 36 alpha)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	IL36G (interleukin 36 gamma)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Il36g (interleukin 36G)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	27,346,675 - 27,352,839 (+)	NCBI		GRCr8
mRatBN7.2	3	6,948,323 - 6,954,485 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	6,948,297 - 6,954,480 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	10,042,438 - 10,048,603 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	18,628,663 - 18,634,828 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	16,818,475 - 16,824,640 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	1,285,658 - 1,291,836 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	1,285,664 - 1,291,865 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	1,278,763 - 1,284,915 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	2,432,285 - 2,438,437 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	1,785,790 - 1,791,942 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il36g	Rat	endometriosis		ISO	RGD:1351778	8554872	ClinVar Annotator: match by term: Endometriosis	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il36g	Rat	(-)-alpha-phellandrene	decreases expression	ISO	RGD:1351778	6480464	alpha phellandrene results in decreased expression of IL36G mRNA	CTD	PMID:25075043
Il36g	Rat	(-)-demecolcine	increases expression	ISO	RGD:1351778	6480464	Demecolcine results in increased expression of IL36G mRNA	CTD	PMID:23649840
Il36g	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:1351778	6480464	Lactic Acid results in decreased expression of IL36G mRNA	CTD	PMID:30851411
Il36g	Rat	alpha-phellandrene	decreases expression	ISO	RGD:1351778	6480464	alpha phellandrene results in decreased expression of IL36G mRNA	CTD	PMID:25075043
Il36g	Rat	arsane	decreases expression	ISO	RGD:1557109	6480464	Arsenic results in decreased expression of IL36G mRNA	CTD	PMID:19654921
Il36g	Rat	arsane	multiple interactions	ISO	RGD:1351778	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of IL36G more ...	CTD	PMID:32525701
Il36g	Rat	arsenic atom	decreases expression	ISO	RGD:1557109	6480464	Arsenic results in decreased expression of IL36G mRNA	CTD	PMID:19654921
Il36g	Rat	arsenic atom	multiple interactions	ISO	RGD:1351778	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of IL36G more ...	CTD	PMID:32525701
Il36g	Rat	benzalkonium chloride	increases expression	ISO	RGD:1557109	6480464	Benzalkonium Compounds results in increased expression of IL36G mRNA	CTD	PMID:30171875
Il36g	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1351778	6480464	Benzo(a)pyrene affects the methylation of IL36G 5' UTR	CTD	PMID:27901495
Il36g	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1351778	6480464	Benzo(a)pyrene results in increased expression of IL36G mRNA	CTD	PMID:35870112
Il36g	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1351778	6480464	Benzo(a)pyrene results in increased methylation of IL36G promoter	CTD	PMID:27901495
Il36g	Rat	beta-naphthoflavone	increases expression	ISO	RGD:1351778	6480464	beta-Naphthoflavone results in increased expression of IL36G mRNA	CTD	PMID:32151702
Il36g	Rat	bis(2-chloroethyl) sulfide	increases expression	ISO	RGD:1351778	6480464	Mustard Gas results in increased expression of IL36G mRNA	CTD	PMID:25102026
Il36g	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IL36G mRNA	CTD	PMID:25181051
Il36g	Rat	bisphenol A	decreases expression	ISO	RGD:1557109	6480464	bisphenol A results in decreased expression of IL36G mRNA	CTD	PMID:32156529
Il36g	Rat	Brevetoxin B	increases expression	ISO	RGD:1351778	6480464	brevetoxin 2 results in increased expression of IL36G mRNA	CTD	PMID:20498034
Il36g	Rat	buta-1,3-diene	increases expression	ISO	RGD:1557109	6480464	1,3-butadiene results in increased expression of IL36G mRNA	CTD	PMID:29038090
Il36g	Rat	carbon nanotube	increases expression	ISO	RGD:1557109	6480464	Nanotubes, Carbon analog results in increased expression of IL36G mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Il36g	Rat	CGP 52608	multiple interactions	ISO	RGD:1351778	6480464	CGP 52608 promotes the reaction [RORA protein binds to IL36G gene]	CTD	PMID:28238834
Il36g	Rat	chloroprene	increases expression	ISO	RGD:1557109	6480464	Chloroprene results in increased expression of IL36G mRNA	CTD	PMID:23125180
Il36g	Rat	chlorpyrifos	decreases expression	ISO	RGD:1557109	6480464	Chlorpyrifos results in decreased expression of IL36G mRNA	CTD	PMID:37019170
Il36g	Rat	crocidolite asbestos	increases expression	ISO	RGD:1351778	6480464	Asbestos, Crocidolite results in increased expression of IL36G mRNA	CTD	PMID:25351596
Il36g	Rat	deoxynivalenol	increases expression	ISO	RGD:1351778	6480464	deoxynivalenol results in increased expression of IL36G protein	CTD	PMID:33890134
Il36g	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:1351778	6480464	Ethyl Methanesulfonate results in increased expression of IL36G mRNA	CTD	PMID:23649840
Il36g	Rat	ferulic acid	multiple interactions	ISO	RGD:1557109	6480464	ferulic acid inhibits the reaction [Imiquimod results in increased expression of IL36G mRNA]	CTD	PMID:31054998
Il36g	Rat	formaldehyde	increases expression	ISO	RGD:1351778	6480464	Formaldehyde results in increased expression of IL36G mRNA	CTD	PMID:23649840
Il36g	Rat	genistein	decreases expression	ISO	RGD:1557109	6480464	Genistein results in decreased expression of IL36G mRNA	CTD	PMID:32186404
Il36g	Rat	hydroquinone	increases expression	ISO	RGD:1351778	6480464	hydroquinone results in increased expression of IL36G mRNA	CTD	PMID:31256213
Il36g	Rat	imiquimod	increases expression	ISO	RGD:1557109	6480464	Imiquimod results in increased expression of IL36G mRNA	CTD	PMID:31054998
Il36g	Rat	imiquimod	multiple interactions	ISO	RGD:1557109	6480464	ferulic acid inhibits the reaction [Imiquimod results in increased expression of IL36G mRNA]	CTD	PMID:31054998
Il36g	Rat	lipopolysaccharide	affects expression	ISO	RGD:1351778	6480464	Lipopolysaccharides affects the expression of IL36G mRNA	CTD	PMID:28070326
Il36g	Rat	lipopolysaccharide	increases expression	ISO	RGD:1351778	6480464	Lipopolysaccharides results in increased expression of IL36G mRNA	CTD	PMID:21135123\|PMID:35811015
Il36g	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1351778	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of IL36G mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:20507366\|PMID:21135123\|PMID:28070326\|PMID:35811015
Il36g	Rat	malathion	increases expression	ISO	RGD:1351778	6480464	Malathion results in increased expression of IL36G mRNA	CTD	PMID:37047231
Il36g	Rat	nickel atom	increases expression	ISO	RGD:1351778	6480464	Nickel results in increased expression of IL36G mRNA	CTD	PMID:25583101
Il36g	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of IL36G mRNA	CTD	PMID:33387578
Il36g	Rat	paraquat	increases expression	ISO	RGD:1557109	6480464	Paraquat results in increased expression of IL36G mRNA	CTD	PMID:28012437
Il36g	Rat	pentanal	decreases expression	ISO	RGD:1351778	6480464	pentanal results in decreased expression of IL36G mRNA	CTD	PMID:26079696
Il36g	Rat	rac-lactic acid	decreases expression	ISO	RGD:1351778	6480464	Lactic Acid results in decreased expression of IL36G mRNA	CTD	PMID:30851411
Il36g	Rat	resveratrol	multiple interactions	ISO	RGD:1351778	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of IL36G mRNA	CTD	PMID:23557933
Il36g	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1351778	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of IL36G mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Il36g	Rat	S-adenosyl-L-methioninate	decreases expression	ISO	RGD:1557109	6480464	S-Adenosylmethionine results in decreased expression of IL36G mRNA	CTD	PMID:18098314
Il36g	Rat	S-adenosyl-L-methionine	decreases expression	ISO	RGD:1557109	6480464	S-Adenosylmethionine results in decreased expression of IL36G mRNA	CTD	PMID:18098314
Il36g	Rat	silicon dioxide	increases expression	ISO	RGD:1351778	6480464	Silicon Dioxide results in increased expression of IL36G mRNA	CTD	PMID:22300531\|PMID:25351596
Il36g	Rat	silicon dioxide	increases expression	ISO	RGD:1557109	6480464	Silicon Dioxide results in increased expression of IL36G mRNA	CTD	PMID:23221170\|PMID:29341224
Il36g	Rat	sodium arsenate	multiple interactions	ISO	RGD:1351778	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of IL36G more ...	CTD	PMID:32525701
Il36g	Rat	sodium arsenite	increases expression	ISO	RGD:1351778	6480464	sodium arsenite results in increased expression of IL36G mRNA	CTD	PMID:29301061
Il36g	Rat	sodium dodecyl sulfate	increases expression	ISO	RGD:1351778	6480464	Sodium Dodecyl Sulfate results in increased expression of IL36G mRNA	CTD	PMID:31734321
Il36g	Rat	sodium fluoride	increases expression	EXP		6480464	Sodium Fluoride results in increased expression of IL36G mRNA	CTD	PMID:27257137
Il36g	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of IL36G mRNA	CTD	PMID:33387578
Il36g	Rat	triclosan	multiple interactions	ISO	RGD:1351778	6480464	Triclosan inhibits the reaction [Lipopolysaccharides results in increased expression of IL36G mRNA]	CTD	PMID:20507366
Il36g	Rat	vanadyl sulfate	increases expression	ISO	RGD:1351778	6480464	vanadyl sulfate results in increased expression of IL36G mRNA	CTD	PMID:16330358
Il36g	Rat	vincristine	increases expression	ISO	RGD:1351778	6480464	Vincristine results in increased expression of IL36G mRNA	CTD	PMID:23649840
Il36g	Rat	zoledronic acid	increases expression	ISO	RGD:1351778	6480464	Zoledronic Acid results in increased expression of IL36G mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il36g	Rat	cellular response to lipopolysaccharide	involved_in	IBA	PANTHER:PTN002560644\|RGD:2889\|RGD:2891	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Il36g	Rat	cytokine-mediated signaling pathway	involved_in	IBA	MGI:107936\|PANTHER:PTN002560644\|UniProtKB:P01583\|UniProtKB:P01584\|UniProtKB:Q14116	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Il36g	Rat	immune response	involved_in	IBA	MGI:107936\|MGI:96543\|PANTHER:PTN002560644\|RGD:2889\|RGD:2891\|RGD:621159\|UniProtKB:A0A8M1PI54\|UniProtKB:Q14116\|UniProtKB:Q9UBH0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Il36g	Rat	immune response	involved_in	IEA	InterPro:IPR000975	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il36g	Rat	inflammatory response	involved_in	IBA	MGI:107936\|MGI:96542\|MGI:96543\|PANTHER:PTN002560644\|RGD:2891\|RGD:621159\|UniProtKB:P01584\|UniProtKB:P18510	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Il36g	Rat	inflammatory response	involved_in	IEA	InterPro:IPR000975	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il36g	Rat	negative regulation of myoblast differentiation	acts_upstream_of_or_within	ISO	RGD:1557109	1624291	PMID:23844157	RGD	PMID:23844157
Il36g	Rat	negative regulation of myoblast fusion	acts_upstream_of_or_within	ISO	RGD:1557109	1624291	PMID:23844157	RGD	PMID:23844157
Il36g	Rat	positive regulation of cytokine production	acts_upstream_of_or_within	ISO	RGD:1557109	1624291	PMID:21860022	RGD	PMID:21860022
Il36g	Rat	positive regulation of interleukin-6 production	acts_upstream_of_or_within	ISO	RGD:1557109	1624291	MGI:1913107 PMID:21860022	RGD	PMID:21860022

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il36g	Rat	cytosol	located_in	ISO	RGD:1351778\|UniProtKB:Q9NZH8-1\|UniProtKB:Q9NZH8-2	1624291		RGD	GO_REF:0000052
Il36g	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Il36g	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Il36g	Rat	extracellular space	located_in	IEA	InterPro:IPR000975	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il36g	Rat	extracellular space	located_in	ISO	RGD:1557109	1624291	PMID:21860022	RGD	PMID:21860022
Il36g	Rat	extracellular space	is_active_in	IBA	MGI:107936\|MGI:1859324\|MGI:1916927\|MGI:2449929\|MGI:96542\|MGI:96543\|PANTHER:PTN002560644\|RGD:2889\|RGD:2890\|RGD:2891\|RGD:621159\|UniProtKB:P01583\|UniProtKB:P01584\|UniProtKB:P18510\|UniProtKB:Q14116	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Il36g	Rat	nucleoplasm	located_in	ISO	RGD:1351778\|UniProtKB:Q9NZH8-1\|UniProtKB:Q9NZH8-2	1624291		RGD	GO_REF:0000052
Il36g	Rat	plasma membrane	located_in	ISO	RGD:1351778\|UniProtKB:Q9NZH8-1\|UniProtKB:Q9NZH8-2	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il36g	Rat	cytokine activity	enables	IBA	MGI:107936\|MGI:1859324\|MGI:1916927\|MGI:2449929\|MGI:96542\|MGI:96543\|PANTHER:PTN002560644\|RGD:2891\|UniProtKB:P01583\|UniProtKB:P01584\|UniProtKB:Q14116	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Il36g	Rat	cytokine activity	enables	IEA	InterPro:IPR000975	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il36g	Rat	cytokine activity	enables	ISO	RGD:1557109	1624291	MGI:1913107 PMID:21860022	RGD	PMID:21860022

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:21860022	PMID:23844157

Il36g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	27,346,675 - 27,352,839 (+)	NCBI		GRCr8
mRatBN7.2	3	6,948,323 - 6,954,485 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	6,948,297 - 6,954,480 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	10,042,438 - 10,048,603 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	18,628,663 - 18,634,828 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	16,818,475 - 16,824,640 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	1,285,658 - 1,291,836 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	1,285,664 - 1,291,865 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	1,278,763 - 1,284,915 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	2,432,285 - 2,438,437 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	1,785,790 - 1,791,942 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

IL36G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	112,978,006 - 112,985,658 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	112,973,203 - 112,985,658 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	113,735,583 - 113,743,235 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	113,452,077 - 113,459,698 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	113,451,836 - 113,459,458	NCBI
Celera	2	107,120,767 - 107,128,388 (+)	NCBI		Celera
Cytogenetic Map	2	q14.1	NCBI
HuRef	2	106,190,145 - 106,197,806 (+)	NCBI		HuRef
CHM1_1	2	113,739,752 - 113,747,405 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	113,404,536 - 113,412,188 (+)	NCBI		T2T-CHM13v2.0

Il36g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	24,076,488 - 24,083,579 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	24,076,488 - 24,083,580 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	24,186,476 - 24,193,567 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	24,186,476 - 24,193,568 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	24,041,996 - 24,049,087 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	24,009,168 - 24,014,841 (+)	NCBI		MGSCv36	mm8
Celera	2	23,911,774 - 23,936,073 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	16.24	NCBI

IL36G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	15,168,900 - 15,360,996 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	15,171,664 - 15,362,358 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	89,080,711 - 89,293,626 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	113,781,781 - 113,965,660 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	113,953,169 - 113,965,648 (+)	Ensembl	panpan1.1		panPan2
PanPan1.1 Ensembl	2A	113,985,464 - 113,988,046 (+)	Ensembl	panpan1.1		panPan2

IL36G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	37,100,557 - 37,148,402 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	37,144,309 - 37,149,400 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	36,913,566 - 36,918,410 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	37,920,415 - 37,925,259 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	37,752,862 - 37,926,257 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	37,055,847 - 37,060,691 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	37,112,332 - 37,117,178 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	37,326,118 - 37,330,966 (+)	NCBI		UU_Cfam_GSD_1.0

Il36g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	82,460,389 - 82,466,760 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936783	1,354,955 - 1,360,519 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936783	1,355,562 - 1,359,524 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL36G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	15,997,954 - 16,007,394 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	16,000,301 - 16,006,810 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	3,673,689 - 3,681,391 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il36g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	13,019,657 - 13,025,590 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	13,016,497 - 13,026,271 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Il36g
81 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	88
Count of miRNA genes:	69
Interacting mature miRNAs:	84
Transcripts:	ENSRNOT00000007512
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
6	1	6	15	28	36	11	18	11	6	47	29	6	17	25


RefSeq Transcripts	NM_001113790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158611	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007512 ⟹ ENSRNOP00000007512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	6,948,297 - 6,954,480 (+)	Ensembl
Rnor_6.0 Ensembl	3	1,285,664 - 1,291,865 (+)	Ensembl

RefSeq Acc Id:

NM_001113790 ⟹ NP_001107262

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	27,346,687 - 27,352,839 (+)	NCBI
mRatBN7.2	3	6,948,323 - 6,954,485 (+)	NCBI
Rnor_6.0	3	1,285,684 - 1,291,836 (+)	NCBI
Rnor_5.0	3	1,278,763 - 1,284,915 (+)	NCBI
RGSC_v3.4	3	2,432,285 - 2,438,437 (+)	RGD
Celera	3	1,785,790 - 1,791,942 (+)	RGD

Sequence:

show sequence

GGAAGCTGCCCAAGCTGGGATTTGATCTTCTGAACTTTCCATAAGGACTCTTTCTTGCCAGGCACCAGAACAAGCTCATGATGGAAAACAATGAAAAAAATCGTTACATATGGGTGTGATGTTGAGAT
GTGACACTAACGAACTGGGCTATTTGTATCTTCAGCTATGTCCTCTAAATACCCACATTCTCCATGTACTGCCTCAGCAGGAAAAGAAACTCCTGACCTTGGGCAGGTTTCTGATGTGGATCAGCAGG
TGTGGATCTTTCGTGATCAGGCCCTTGTGACAGTTCCACGAAGCCACACTGTAACTCCAGTCACTGTGACTGTCCTCCCATGCAAGTACCCAGAGTCTCTTGAGCAGGGCAAAGGGACTCCCATTTAT
TTGGGAATTCAAAATCCAGATAAATGCCTGTTTTGTAAGGAAGTTAATGGACACCCCACTTTGCTCCTGAAGGAAGAGAAGATTTTGAATTTGTACCACCATCCTGAGCCAATGAAGCCATTCCTGTT
TTACCACACCCTGACAGGTGCAACGTCCACCTTTGAATCAGTGGTTTTCCCTGGCAGCTTTATTGCCTCCTCCAAGATTGGCAAACCCATCTTCCTCACATCAAAAAAGGGAGAACATTACAACATTC
ACTTCAGTTTAGATATAATTTAGATATAAAGTCTTGAACTCAGAATGGAGGTGGAGGGTTGGTTAGAACTCTTATAACTTCAAACCTCTAATATGCTATCATTTGTTTGATGTGTGGTTGTTTCATAC
TGAGAAGTGAGCAAAACCAACATTATCTCATTTCATAGATGAAGAAGCAACAAAACAGAATGTGTACTCCAAAGTAGGTTGGATGGGAGTGGTGTAAGGCTCTCCTCTAAGACTGAAGTGGTCCAACC
CATAAGGCATCATGCCTTTCTCAGGTGCTATTATAGGGTGCTGTGCCACAGTATATAAAAACTAGAATGCCCCATGTGTGAGTAGCAACATCCTCACTTCCAGTCATTGGCCTGATTCATACCAGGTT
TTCACACACTTGTAATACCAATTCCTTGCATTTGGATAGCAGGAGCCTCACAATGACATTTGCTGCCAACAGCTGATAGCTTTGATCCTTCAGCAACTGACTGCTACGTGGATCTGAAGACGCCAGAA
AAGGAATTAGAATCCTAAGTGAACGAACAGTTTTTAAAATGTCTAGAACTATTTAAACTATGTTAGAATACAGTGGTTTATCCTTGAAAGGTAAGGATACTGCCTGGTAAATCAAAAACAGTTAGGTC
AATAAACTCAGCTTGAACAATTCTTTCCTGGAAACAATGTGTACAAGTAATGATTAAAACATTACCTTTTATTATTCTAGACTTCCATAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063284336 ⟹ XP_063140406

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	27,346,675 - 27,352,839 (+)	NCBI


Protein RefSeqs	NP_001107262	(Get FASTA)	NCBI Sequence Viewer
	XP_063140406	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58612	(Get FASTA)	NCBI Sequence Viewer
	EDL93671	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007512
	ENSRNOP00000007512.6

RefSeq Acc Id:	NP_001107262 ⟸ NM_001113790
- UniProtKB:	B0BMY4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSKYPHSPCTASAGKETPDLGQVSDVDQQVWIFRDQALVTVPRSHTVTPVTVTVLPCKYPESLEQGKGTPIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILNLYHHPEPMKPFLFYHTLTGATSTFE SVVFPGSFIASSKIGKPIFLTSKKGEHYNIHFSLDII hide sequence

Ensembl Acc Id:

ENSRNOP00000007512 ⟸ ENSRNOT00000007512

RefSeq Acc Id:	XP_063140406 ⟸ XM_063284336
- Peptide Label:	isoform X1
- UniProtKB:	A6JSX6 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7FNC4-F1-model_v2	AlphaFold	F7FNC4	1-164	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691847

Promoter ID:

EPDNEW_R2372

Type:

single initiation site

Name:

Il36g_1

Description:

interleukin 36, gamma

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	1,285,672 - 1,285,732	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50513	BioCyc
Ensembl Genes	ENSRNOG00000005701	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007512	ENTREZGENE
	ENSRNOT00000007512.7	UniProtKB/TrEMBL
Gene3D-CATH	2.80.10.50	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7384725	IMAGE-MGC_LOAD
InterPro	Cytokine_IL1-like	UniProtKB/TrEMBL
	Interleukin_1	UniProtKB/TrEMBL
KEGG Report	rno:499744	UniProtKB/TrEMBL
MGC_CLONE	MGC:187491	IMAGE-MGC_LOAD
NCBI Gene	499744	ENTREZGENE
PANTHER	INTERLEUKIN-36 GAMMA	UniProtKB/TrEMBL
	PTHR10078	UniProtKB/TrEMBL
Pfam	IL1	UniProtKB/TrEMBL
PhenoGen	Il36g	PhenoGen
RatGTEx	ENSRNOG00000005701	RatGTEx
SMART	IL1	UniProtKB/TrEMBL
Superfamily-SCOP	Cytok_IL1_like	UniProtKB/TrEMBL
UniProt	A6JSX6	ENTREZGENE, UniProtKB/TrEMBL
	B0BMY4	ENTREZGENE, UniProtKB/TrEMBL
	F7FNC4_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Il36g	interleukin 36, gamma	Il1f9	interleukin 1 family, member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Il1f9	interleukin 1 family, member 9	RGD1563019_predicted	similar to IL-1F9 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563019_predicted	similar to IL-1F9 (predicted)	LOC499744	similar to IL-1F9	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499744	similar to IL-1F9			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar