Timm17b (translocase of inner mitochondrial membrane 17b)

Advanced Search (OLGA)

Gene: Timm17b (translocase of inner mitochondrial membrane 17b) Rattus norvegicus

Analyze

Symbol:

Timm17b

Name:

translocase of inner mitochondrial membrane 17b

RGD ID:

1561744

Description:

Predicted to contribute to protein transmembrane transporter activity. Predicted to be involved in protein import into mitochondrial matrix. Predicted to be located in mitochondrial inner membrane. Predicted to be part of TIM23 mitochondrial import inner membrane translocase complex. Orthologous to human TIMM17B (translocase of inner mitochondrial membrane 17B); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100911130; LOC317374; mitochondrial import inner membrane translocase subunit Tim17-B; mitochondrial import inner membrane translocase subunit Tim17-B-like; RGD1561744; similar to mitochondrial inner membrane translocase component Tim17b; translocase of inner mitochondrial membrane 17 homolog B; translocase of inner mitochondrial membrane 17 homolog B (yeast)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TIMM17B (translocase of inner mitochondrial membrane 17B)	HGNC	Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Timm17b (translocase of inner mitochondrial membrane 17b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Timm17b (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TIMM17B (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TIMM17B (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Timm17b (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TIMM17B (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TIMM17B (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Timm17b (translocase of inner mitochondrial membrane 17B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TIMM17B (translocase of inner mitochondrial membrane 17B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Timm17b (translocase of inner mitochondrial membrane 17b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	timm17b (translocase of inner mitochondrial membrane 17 homolog B (yeast))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1724	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TIM17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	timm-17B.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Tim17a1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Tim17a2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Tim17b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Tim17b1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Tim17b2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	17,268,257 - 17,275,424 (-)	NCBI		GRCr8
mRatBN7.2	X	14,596,330 - 14,603,491 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	14,594,577 - 14,603,416 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	19,409,868 - 19,416,951 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	20,666,160 - 20,673,243 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	16,931,330 - 16,938,413 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	15,441,369 - 15,448,452 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,340,839 - 15,347,591 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,441,651 - 15,448,403 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	16,222,604 - 16,229,687 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	26,630,879 - 26,637,962 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	14,681,087 - 14,688,170 (-)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

congenital disorder of glycosylation type IIm (ISO)

immune dysregulation-polyendocrinopathy-enteropathy-X-linked syndrome (ISO)

neurodegeneration with brain iron accumulation 5 (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Thrombocytopenia 1 (ISO)

Wiskott-Aldrich syndrome (ISO)

X-linked epilepsy with variable learning disabilities and behavior disorders (ISO)

X-linked severe congenital neutropenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

acetylsalicylic acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

chloroacetaldehyde (ISO)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clodronic acid (ISO)

cobalt dichloride (EXP,ISO)

Cuprizon (EXP)

dibutyl phthalate (ISO)

doxorubicin (ISO)

fenthion (ISO)

ifosfamide (ISO)

lamivudine (ISO)

metformin (EXP)

methamphetamine (EXP)

paracetamol (EXP)

pyrogallol (ISO)

tamoxifen (ISO)

temozolomide (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

toluene (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein import into mitochondrial matrix (IBA)

Cellular Component

mitochondrial inner membrane (ISO)

mitochondrion (ISO)

TIM23 mitochondrial import inner membrane translocase complex (IBA,ISO)

Molecular Function

protein binding (ISO)

protein transmembrane transporter activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10339406	PMID:12865426	PMID:18614015	PMID:20053669	PMID:34800366

Genomics

Comparative Map Data

Timm17b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	17,268,257 - 17,275,424 (-)	NCBI		GRCr8
mRatBN7.2	X	14,596,330 - 14,603,491 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	14,594,577 - 14,603,416 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	19,409,868 - 19,416,951 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	20,666,160 - 20,673,243 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	16,931,330 - 16,938,413 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	15,441,369 - 15,448,452 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,340,839 - 15,347,591 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,441,651 - 15,448,403 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	16,222,604 - 16,229,687 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	26,630,879 - 26,637,962 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	14,681,087 - 14,688,170 (-)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

TIMM17B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	48,893,447 - 48,898,143 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	48,893,447 - 48,898,143 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	48,750,730 - 48,755,426 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	48,635,676 - 48,640,370 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	48,506,979 - 48,511,674	NCBI
Celera	X	52,908,104 - 52,912,800 (+)	NCBI		Celera
Cytogenetic Map	X	p11.23	NCBI
HuRef	X	46,406,865 - 46,411,455 (-)	NCBI		HuRef
CHM1_1	X	48,781,872 - 48,786,568 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	48,303,928 - 48,308,624 (-)	NCBI		T2T-CHM13v2.0

Timm17b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	7,765,575 - 7,773,891 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	7,765,596 - 7,776,168 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	7,899,336 - 7,907,652 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	7,899,357 - 7,908,351 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	7,476,524 - 7,484,778 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	7,056,357 - 7,064,611 (+)	NCBI		MGSCv36	mm8
Celera	X	3,561,893 - 3,570,179 (-)	NCBI		Celera
Cytogenetic Map	X	A1.1	NCBI
cM Map	X	3.56	NCBI

Timm17b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955543	425,076 - 430,767 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955543	425,076 - 430,767 (-)	NCBI	ChiLan1.0	ChiLan1.0

TIMM17B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	50,382,580 - 50,386,975 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	50,385,952 - 50,390,382 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	41,191,130 - 41,195,561 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	49,049,175 - 49,053,452 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	49,049,175 - 49,053,452 (-)	Ensembl	panpan1.1		panPan2

TIMM17B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	42,052,592 - 42,056,601 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	42,052,781 - 42,071,012 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	16,428,033 - 16,432,051 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	42,188,824 - 42,192,839 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	42,186,311 - 42,207,558 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	42,175,028 - 42,179,046 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	42,163,309 - 42,167,327 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	42,257,520 - 42,261,535 (-)	NCBI		UU_Cfam_GSD_1.0

Timm17b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	34,566,902 - 34,584,732 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936721	818,608 - 826,042 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936721	817,738 - 824,074 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TIMM17B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	42,970,108 - 42,975,955 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	42,970,586 - 42,976,287 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	47,837,475 - 47,842,888 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TIMM17B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	46,010,164 - 46,014,616 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	46,010,446 - 46,014,510 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666076	11,495,126 - 11,499,551 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Timm17b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624893	675,859 - 680,889 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624893	675,859 - 680,974 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Timm17b
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	264
Count of miRNA genes:	165
Interacting mature miRNAs:	176
Transcripts:	ENSRNOT00000037066, ENSRNOT00000066373
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	1448129	31706553	Rat
1298071	Edpm12	Estrogen-dependent pituitary mass QTL 12	3.2		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	X	2927898	47927898	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1	43491017	Rat
10755455	Coatc13	Coat color QTL 13		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	4406000	49406000	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	4494549	49494549	Rat
634325	Bw13	Body weight QTL 13	0		body mass (VT:0001259)	body weight (CMO:0000012)	X	1447972	20991088	Rat
631204	Gluco15	Glucose level QTL 15		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	1623715	22646544	Rat

Markers in Region

RH140085

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	14,596,010 - 14,596,194 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	15,441,050 - 15,441,233	NCBI	Rnor6.0
Rnor_6.0	X	15,340,238 - 15,340,421	NCBI	Rnor6.0
Rnor_5.0	X	16,222,285 - 16,222,468	UniSTS	Rnor5.0
Rnor_5.0	X	16,120,479 - 16,120,662	UniSTS	Rnor5.0
RGSC_v3.4	X	26,630,560 - 26,630,743	UniSTS	RGSC3.4
Celera	X	14,680,768 - 14,680,951	UniSTS
RH 3.4 Map	X	125.1	UniSTS
Cytogenetic Map	X	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063280051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037066 ⟹ ENSRNOP00000038100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	14,594,577 - 14,602,502 (-)	Ensembl
Rnor_6.0 Ensembl	X	15,340,839 - 15,347,591 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000066373 ⟹ ENSRNOP00000059538

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	14,594,577 - 14,603,416 (-)	Ensembl
Rnor_6.0 Ensembl	X	15,441,651 - 15,448,403 (-)	Ensembl

RefSeq Acc Id:

NM_001108249 ⟹ NP_001101719

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	17,268,257 - 17,275,340 (-)	NCBI
mRatBN7.2	X	14,596,330 - 14,603,413 (-)	NCBI
Rnor_6.0	X	15,441,369 - 15,448,452 (-)	NCBI
Rnor_5.0	X	16,222,604 - 16,229,687 (-)	NCBI
RGSC_v3.4	X	26,630,879 - 26,637,962 (-)	RGD
Celera	X	14,681,087 - 14,688,170 (-)	RGD

Sequence:

show sequence

GGAGTGGCTCTCCCGCGCGACCGACTGCTCCAGGCCGGACGCTGGCGCCATGGAGGAGTACGCT
CGCGAACCTTGCCCGTGGCGAATTGTGGATGATTGTGGCGGAGCCTTCACCATGGGTGTCATTG
GTGGTGGAGTCTTCCAGGCTGTCAAGGGCTTCCGCAATGCCCCTGTTGGAATTCGACACCGGTT
CAGAGGTAGTATCAATGCTGTGAGGATCCGAGCACCCCAGATTGGAGGTAGCTTTGCAGTATGG
GGTGGCCTGTTTTCCACCATCGACTGTGGCCTGGTCCGGCTGCGGGGCAAAGAAGACCCCTGGA
ACTCCATCACCAGTGGAGCATTGACCGGAGCCGTGTTGGCTGCCCGCAGTGGTCCGCTGGCCAT
GGTGGGCTCTGCGATGATGGGGGGCATCCTGTTGGCCCTCATTGAGGGTGTTGGCATACTTCTC
ACCCGCTATACTGCCCAGCAGTTCCGCAATGCACCCCCATTCTTGGAGGACCCCAACCAGCTAA
CCCCTAAAGAGGGAGCTCCGGCCCCAGGTTACCCCAACTACCAGCAGTACCACTGAGGAAGCCG
CTGTCTGCCCCTGCCACCGTGGGAGCTGCTCCTCAGTTCCCTCCCGGATGATCTACCTCCAAGG
GAGGACTGGCTCCTACATAGCCCTGAGACCTTCACAGAGGGCCTCTATTCTACTCTCTTGTGGT
AGGGGTGGGGGCACCCCAGCAGCCTTGTCACATGGGTTCCCGTCTTGTGTCTCAGGGCTTCACA
GCTCCACACATGTAACAATTCTCTCACCCCAGATCCCTCGTGTGGCACCCTGATGAATGTTTAA
AGCCAGTTTGGAAATGTC

hide sequence

RefSeq Acc Id:

XM_063280051 ⟹ XP_063136121

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	17,268,257 - 17,275,424 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101719	(Get FASTA)	NCBI Sequence Viewer
	XP_063136121	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL83812	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038100.5
	ENSRNOP00000059538.3

RefSeq Acc Id:	NP_001101719 ⟸ NM_001108249
- UniProtKB:	A6KP64 (UniProtKB/TrEMBL), A0A8J8XD91 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIRHRFRGSINAVRIRAPQIGG SFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEG VGILLTRYTAQQFRNAPPFLEDPNQLTPKEGAPAPGYPNYQQYH hide sequence

Ensembl Acc Id:

ENSRNOP00000038100 ⟸ ENSRNOT00000037066

Ensembl Acc Id:

ENSRNOP00000059538 ⟸ ENSRNOT00000066373

RefSeq Acc Id:	XP_063136121 ⟸ XM_063280051
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACA5-F1-model_v2	AlphaFold	D4ACA5	1-172	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701739

Promoter ID:

EPDNEW_R12262

Type:

initiation region

Name:

Timm17b_1

Description:

translocase of inner mitochondrial membrane 17b

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	15,448,438 - 15,448,498	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561744	AgrOrtholog
BioCyc Gene	G2FUF-2929	BioCyc
Ensembl Genes	ENSRNOG00000025156	Ensembl
	ENSRNOG00000048613	Ensembl
	ENSRNOG00000063664	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037066.7	UniProtKB/TrEMBL
	ENSRNOT00000066373.4	UniProtKB/TrEMBL
InterPro	Tim17	UniProtKB/TrEMBL
KEGG Report	rno:317374	UniProtKB/TrEMBL
NCBI Gene	317374	ENTREZGENE
PANTHER	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM-17	UniProtKB/TrEMBL
	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM17-B	UniProtKB/TrEMBL
Pfam	Tim17	UniProtKB/TrEMBL
PhenoGen	Timm17b	PhenoGen
RatGTEx	ENSRNOG00000025156	RatGTEx
	ENSRNOG00000048613	RatGTEx
	ENSRNOG00000063664	RatGTEx
UniProt	A0A8J8XD91	ENTREZGENE, UniProtKB/TrEMBL
	A6KP64	ENTREZGENE, UniProtKB/TrEMBL
	D4ACA5_RAT	UniProtKB/TrEMBL
UniProt Secondary	F1M3N4	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Timm17b	translocase of inner mitochondrial membrane 17b	LOC100911130	mitochondrial import inner membrane translocase subunit Tim17-B-like	Data merged from RGD:6494590	737654	PROVISIONAL
2014-10-22	Timm17b	translocase of inner mitochondrial membrane 17b	Timm17b	translocase of inner mitochondrial membrane 17 homolog B (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911130	mitochondrial import inner membrane translocase subunit Tim17-B-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-10-23	Timm17b	translocase of inner mitochondrial membrane 17 homolog B (yeast)	Timm17b	translocase of inner mitochondrial membrane 17b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Timm17b	translocase of inner mitochondrial membrane 17b	Timm17b_predicted	translocase of inner mitochondrial membrane 17 homolog B (yeast) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Timm17b_predicted	translocase of inner mitochondrial membrane 17 homolog B (yeast) (predicted)	RGD1561744_predicted	similar to mitochondrial inner membrane translocase component Tim17b (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1561744_predicted	similar to mitochondrial inner membrane translocase component Tim17b (predicted)	LOC317374	similar to mitochondrial inner membrane translocase component Tim17b	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC317374	similar to mitochondrial inner membrane translocase component Tim17b			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar