Advanced Search (OLGA)

Gene: Pabpn1l (poly(A)binding protein nuclear 1-like) Mus musculus

Analyze

Symbol:

Pabpn1l

Name:

poly(A)binding protein nuclear 1-like

RGD ID:

1557279

MGI Page

MGI

Description:

Enables poly(A) binding activity. Acts upstream of or within negative regulation of protein metabolic process and regulation of gene expression. Located in cytoplasm. Is expressed in 1-cell stage embryo; gonad; retina; and thymus. Orthologous to human PABPN1L (PABPN1 like, cytoplasmic).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

embryonic poly(A) binding protein 2; embryonic poly(A)-binding protein 2; embryonic poly(A)-binding protein type II; embryonic polyadenylate-binding protein 2; ePA; ePABP-2; ePABP2; Gm1108; Pabpnl1; poly(A)-binding protein nuclear-like 1; poly(A)binding protein nuclear-like 1; T-cell receptor alpha chain V region (8/10-2)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PABPN1L (PABPN1 like, cytoplasmic)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Treefam
Rattus norvegicus (Norway rat):	Pabpn1l (PABPN1 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pabpn1l (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PABPN1L (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PABPN1L (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pabpn1l (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PABPN1L (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PABPN1L (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pabpn1l (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pabpn1l (PABPN1 like, cytoplasmic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PABPN1L (PABPN1 like, cytoplasmic)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Pabpn1l (PABPN1 like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pabpn1l (poly(A) binding protein, nuclear 1-like (cytoplasmic))	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Drosophila melanogaster (fruit fly):	Pabp2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	pabp-2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SGN1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	123,346,210 - 123,349,474 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	123,346,210 - 123,349,478 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	122,619,471 - 122,622,735 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	122,619,471 - 122,622,739 (-)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	8	125,143,371 - 125,146,635 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	125,505,561 - 125,508,825 (-)	NCBI		MGSCv36	mm8
Celera	8	126,848,856 - 126,852,111 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	71.93	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

acrylamide (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (EXP)

bisphenol A (EXP,ISO)

C60 fullerene (ISO)

chrysene (EXP)

diethylstilbestrol (ISO)

endosulfan (ISO)

isoflurane (EXP)

manganese(II) chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

ozone (ISO)

perfluorononanoic acid (EXP)

tebuconazole (ISO)

tetraphene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

maternal-to-zygotic transition of gene expression (IMP)

negative regulation of protein ubiquitination (IDA)

negative regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IDA)

nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay (IBA,IMP)

Cellular Component

cytoplasm (IBA,IDA,IEA,ISA,ISS)

cytosol (TAS)

Molecular Function

nucleic acid binding (IEA)

poly(A) binding (IBA,IDA,ISA,ISS)

RNA binding (IDA,IEA,IMP)

Molecular Pathway Annotations Click to see Annotation Detail View

influenza A pathway (IEA)

mRNA decay pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal oocyte morphology (IAGP)

female infertility (IAGP)

maternal effect (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10725249	PMID:10922068	PMID:11544199	PMID:12477932	PMID:15083517	PMID:15630085	PMID:21677750	PMID:21873635	PMID:23341629	PMID:30973865	PMID:32558204	PMID:34726234
PMID:36306357	PMID:37889087	PMID:38057116	PMID:38355793

Genomics

Comparative Map Data

Pabpn1l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	123,346,210 - 123,349,474 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	123,346,210 - 123,349,478 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	122,619,471 - 122,622,735 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	122,619,471 - 122,622,739 (-)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	8	125,143,371 - 125,146,635 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	125,505,561 - 125,508,825 (-)	NCBI		MGSCv36	mm8
Celera	8	126,848,856 - 126,852,111 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	71.93	NCBI

PABPN1L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	88,863,333 - 88,870,135 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	88,863,333 - 88,866,660 (-)	Ensembl		GRCh38.p14 Ensembl	hg38	GRCh38
GRCh37	16	88,929,741 - 88,933,068 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	87,455,535 - 87,460,515 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	16	73,996,625 - 74,001,605 (-)	NCBI		Celera
Cytogenetic Map	16	q24.3	NCBI
HuRef	16	74,626,902 - 74,630,229 (-)	NCBI		HuRef
CHM1_1	16	90,341,014 - 90,344,336 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	94,933,691 - 94,940,493 (-)	NCBI		T2T-CHM13v2.0

Pabpn1l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	67,578,494 - 67,581,938 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	67,578,496 - 67,581,895 (-)	Ensembl				GRCr8
mRatBN7.2	19	50,669,965 - 50,673,409 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	50,669,967 - 50,673,366 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	57,464,760 - 57,468,206 (-)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	58,144,881 - 58,148,325 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	60,363,378 - 60,366,824 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	19	61,376,697 - 61,380,159 (-)	NCBI
Lyon_Normotensive	19	59,499,435 - 59,502,879 (-)	NCBI
Lyon_Hypertensive	19	61,372,896 - 61,376,340 (-)	NCBI
F344_StmMcwi	19	59,107,523 - 59,110,969 (-)	NCBI
Rnor_6.0	19	55,430,808 - 55,434,252 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	55,430,810 - 55,434,252 (-)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	19	66,139,323 - 66,142,767 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	52,898,178 - 52,901,622 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	49,909,361 - 49,912,805 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

Pabpn1l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955541	2,718,076 - 2,720,322 (-)	Ensembl		ChiLan1.0 Ensembl
ChiLan1.0	NW_004955541	2,718,076 - 2,720,322 (-)	NCBI	ChiLan1.0	ChiLan1.0

PABPN1L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	98,638,053 - 98,643,564 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	104,550,599 - 104,555,722 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	69,579,421 - 69,583,803 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	89,234,156 - 89,237,595 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	89,234,156 - 89,237,595 (-)	Ensembl		PanPan1.1 Ensembl	panPan2	panpan1.1

PABPN1L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	64,525,929 - 64,527,654 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	64,537,238 - 64,539,350 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	64,745,924 - 64,748,036 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	5	64,772,060 - 64,774,172 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	64,603,706 - 64,605,818 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	65,009,793 - 65,011,905 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pabpn1l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mIctTri1.hap1	15	59,996,957 - 59,999,840 (-)	NCBI		mIctTri1.hap1
HiC_Itri_2	NW_024409349	25,126,917 - 25,129,241 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	880,548 - 883,098 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	880,548 - 883,098 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PABPN1L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	858,888 - 861,604 (+)	Ensembl		Sscrofa11.1 Ensembl	susScr11	Sscrofa11.1
Sscrofa11.1	6	854,605 - 861,969 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	1,049,074 - 1,054,344 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PABPN1L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mChlSab1.0.hap1	5	85,507,295 - 85,511,078 (-)	NCBI		mChlSab1.0.hap1
Vero_WHO_p1.0	NW_023666047	1,374,462 - 1,377,258 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0
ChlSab1.1	5	74,251,084 - 74,256,543 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	74,252,703 - 74,255,857 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Pabpn1l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624746	776,692 - 779,187 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2
HetGla_female_1.0 Ensembl	NW_004624746	776,677 - 779,555 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl

Pabpn1l
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	42,247,583 - 42,250,811 (-)	NCBI	Rrattus_CSIRO_v1	Rrattus_CSIRO_v1

Variants

Variants in Pabpn1l
170 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	209
Count of miRNA genes:	183
Interacting mature miRNAs:	200
Transcripts:	ENSMUST00000093059
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357494	Obsty2_m	obesity 2 (mouse)			Not determined		8	96245241	129745061	Mouse
4141435	Fbtq3_m	femoral bone trait QTL 3 (mouse)			Not determined		8	100965309	130127694	Mouse
12904960	Gmmq6_m	gastrocnemius muscle mass QTL 6 (mouse)					8	111481497	130127694	Mouse
11252141	Fdr2_m	fat response to dietary restriction 2 (mouse)					8	98390634	130127694	Mouse
1302105	Im1_m	Immunoregulatory 1 (mouse)			Not determined		8	99828531	130127694	Mouse
12880431	Fgf23lq2_m	FGF23 serum level QTL 2 (mouse)					8	97626632	130127694	Mouse
1301080	Sluc9_m	susceptibility to lung cancer 9 (mouse)			Not determined		8	99828531	130127694	Mouse
10412274	Leci1_m	leukocyte endothelial cell interactions 1 (mouse)			Not determined		8	110415083	130127694	Mouse
26884375	Skwq2_m	skull length QTL 2, 5 week (mouse)					8	120726739	130027694	Mouse
12904938	Edlmmq7_m	extensor digitorum longus muscle mass QTL 7 (mouse)					8	111481497	130127694	Mouse
10412273	Fcd1_m	functional capillary density 1 (mouse)			Not determined		8	110415083	130127694	Mouse
27226796	Scvln16_m	sacral vertebrae length 2, 16 week (mouse)					8	89726628	130027694	Mouse
14746994	Manh65_m	mandible shape 65 (mouse)					8	106489629	130127694	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
4141546	Mrdq3_m	modifier of retinal degeneration QTL 3 (mouse)			Not determined			114439420	126055880	Mouse
1301316	Dntcs1_m	dental caries susceptibility 1 (mouse)			Not determined		8	103443553	127781786	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1301481	Lith11_m	lithogenic gene 11 (mouse)			Not determined		8	98563635	130127694	Mouse
11532692	Sluc38a_m	susceptibility to lung cancer 38a (mouse)					8	105033977	130127694	Mouse
11532691	Sluc38_m	susceptibility to lung cancer 38 (mouse)					8	105033977	130127694	Mouse

Markers in Region

Pabpnl1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	122,619,738 - 122,620,911	UniSTS	GRCm38
MGSCv37	8	125,143,638 - 125,144,811	UniSTS	GRCm37
Celera	8	126,849,115 - 126,850,287	UniSTS
Cytogenetic Map	8	E1	UniSTS
cM Map	8		UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC151999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC141316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC141317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC145634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK001615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000093059 ⟹ ENSMUSP00000090747

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	123,346,210 - 123,349,478 (-)	Ensembl
GRCm38.p6 Ensembl	8	122,619,471 - 122,622,739 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000212966 ⟹ ENSMUSP00000148736

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	123,346,210 - 123,349,478 (-)	Ensembl
GRCm38.p6 Ensembl	8	122,619,546 - 122,622,734 (-)	Ensembl

RefSeq Acc Id:

NM_001007462 ⟹ NP_001007463

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	123,346,210 - 123,349,474 (-)	NCBI
GRCm38	8	122,619,471 - 122,622,735 (-)	ENTREZGENE
MGSCv37	8	125,143,371 - 125,146,635 (-)	RGD
Celera	8	126,848,856 - 126,852,111 (-)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

AGCAGACCCAGAGAGGCAAGGCTCCCCAGGTCCGCCCTCCTCGCCTACCTCACCTACAGATGGA
GCCTTACCTGAGCAATGAGCTCTTCCCACCCCCCACTGAAGCCTGGCTCCAGACGGTCTCCTCA
GATCCTGAGGCCCAAGGTTGGGGGGCCTGGGGCAGGACTGAAAAGACCTCCTTGGTGCCAAGGG
CTGGGAGTAGAGCAGGAAGTGACAAGGAAGCAGAGGAAAATGAAGATGCGAGCTTCCTTCTCTC
CCTGCTGGAACCAGAGAACCTGGCCAAGTCCCCAGTATTCAACCAGGAGTTGGAGGCCATCAAG
CTGAAACTGTGGGCCATGGAGCATGCTGAAGCCCAGCCGGAGCCACCCTGTGTACAGAGAAAGG
CCACAGAGGAAGAGAGGGCTGAGGTCAGACAGCTGCTGAGCCCTGAGACCGTAGACTGCTTCTT
CTCTAGGACCTCCAAGGAAAATGTGGAGGCTGACCACAGATCTGTCTTTGTAGGCAATGTGGAT
TATGGTGGCTCAGCTGCAGAGCTGGAGGCCTACTTCAGTCCCTGTGGGGAGATTCACCGGGTCA
CTATCCTGTGCGACAAGTTCTCTGGACACCCCAAGGGCTATGCATATATAGAGTTTGCTTCGCA
CAGATCTGTCAAGGCTGCTGTGGGGCTGGATGAGAGCACCTTCCGAGGTCGGGTCATCAAGGTA
CTTCCCAAAAGGACGAACTTCCCAGGCATCAGCTCCACAGACCGTGGAGGGCTGCGGACACACT
CGGGCAACAGGGCTGCCTTCCTGCACGGTAGCCTCCATCGAAAAGCTCGGTTAAGAGCCCATGG
ACGGAGCCGGGGCCATGGAGGAGCACCACAGTGGTTCTCTCCCTACTGAAAGAACAGCCCAGTT
TTTAAAGCGGGACCAGGAGTAAACTGCTGTCTCCACTCCCTCCAGATGGGGCTCCTAGCCTGGC
AGCCCCCAAGGGCCTTTGAAGGTGCCCAGATCACCAGGTCCCAGTGGGAAGGCACTGGGCAGGG
AGGGGAGGGAGGGGAGGAAGGCTCAGGGTATGCTGGGATTGGCATTCTCGAGTACTTTTAAAGA
AAAATAGATATGTGTGTTAATAGTAGAATGTAAATTATTAAACTTGAATATATTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001007463	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI41317	(Get FASTA)	NCBI Sequence Viewer
	AAI41318	(Get FASTA)	NCBI Sequence Viewer
	AAI45635	(Get FASTA)	NCBI Sequence Viewer
	DAA02003	(Get FASTA)	NCBI Sequence Viewer
	EDL11696	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000090747
	ENSMUSP00000090747.3
GenBank Protein	Q5XFR0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001007463 ⟸ NM_001007462

- UniProtKB:

B9EJ43 (UniProtKB/Swiss-Prot), Q5XFR0 (UniProtKB/Swiss-Prot), B7ZP52 (UniProtKB/TrEMBL), A0A1D5RMD9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPYLSNELFPPPTEAWLQTVSSDPEAQGWGAWGRTEKTSLVPRAGSRAGSDKEAEENEDASFL
LSLLEPENLAKSPVFNQELEAIKLKLWAMEHAEAQPEPPCVQRKATEEERAEVRQLLSPETVDC
FFSRTSKENVEADHRSVFVGNVDYGGSAAELEAYFSPCGEIHRVTILCDKFSGHPKGYAYIEFA
SHRSVKAAVGLDESTFRGRVIKVLPKRTNFPGISSTDRGGLRTHSGNRAAFLHGSLHRKARLRA
HGRSRGHGGAPQWFSPY

hide sequence

Ensembl Acc Id:

ENSMUSP00000090747 ⟸ ENSMUST00000093059

Ensembl Acc Id:

ENSMUSP00000148736 ⟸ ENSMUST00000212966

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XFR0-F1-model_v2	AlphaFold	Q5XFR0	1-273	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:2685954	AgrOrtholog
Ensembl Genes	ENSMUSG00000069867	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000093059	ENTREZGENE
	ENSMUST00000093059.3	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot
	RBD_domain_sf	UniProtKB/Swiss-Prot
	RRM_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:382035	UniProtKB/Swiss-Prot
MGD	MGI:2685954	ENTREZGENE
NCBI Gene	382035	ENTREZGENE
PANTHER	EMBRYONIC POLYADENYLATE-BINDING PROTEIN 2	UniProtKB/Swiss-Prot
	EUKARYOTIC TRANSLATION INITIATION FACTOR 4B/4H	UniProtKB/Swiss-Prot
Pfam	RRM_1	UniProtKB/Swiss-Prot
PhenoGen	Pabpn1l	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot
SMART	RRM	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot
UniProt	A0A1D5RMD9	ENTREZGENE, UniProtKB/TrEMBL
	B7ZP52	ENTREZGENE, UniProtKB/TrEMBL
	B9EJ43	ENTREZGENE
	EPAB2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	B9EJ43	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)

Mammalian Phenotype