Symbol:
Ghitm
Name:
growth hormone inducible transmembrane protein
RGD ID:
1552120
MGI Page
MGI
Description:
Predicted to enable calcium channel activity and calcium:proton antiporter activity. Involved in inner mitochondrial membrane organization and mitochondrial potassium ion transmembrane transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Orthologous to human GHITM (growth hormone inducible transmembrane protein).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1010001P14Rik; C77840; growth hormone-inducible transmembrane protein; MICS1; mitochondrial morphology and cristae structure 1; PTD01; PTD010; Tmbim; Tmbim5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GHITM (growth hormone inducible transmembrane protein) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ghitm (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ghitm (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GHITM (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GHITM (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ghitm (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GHITM (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GHITM (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ghitm (growth hormone inducible transmembrane protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GHITM (growth hormone inducible transmembrane protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Ghitm (growth hormone inducible transmembrane protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ghitm (growth hormone inducible transmembrane protein)
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG2076
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
K11H12.8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Mics1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ghitm
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm18952
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 36,842,401 - 36,857,279 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 36,842,049 - 36,857,229 (-) Ensembl GRCm39 Ensembl GRCm38 14 37,120,444 - 37,135,322 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 37,120,092 - 37,135,272 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 37,934,004 - 37,948,452 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 36,032,558 - 36,047,006 (-) NCBI MGSCv36 mm8 Celera 14 33,331,790 - 33,346,360 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 21.29 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ghitm Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GHITM mRNA CTD PMID:36331819 Ghitm Mouse (S)-nicotine multiple interactions EXP 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ghitm Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of GHITM mRNA CTD PMID:28960355 Ghitm Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GHITM mRNA CTD PMID:22206623 Ghitm Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GHITM mRNA CTD PMID:22206623 Ghitm Mouse 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression EXP 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ghitm Mouse 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions EXP 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ghitm Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of GHITM mRNA CTD PMID:17555576 Ghitm Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of GHITM mRNA CTD PMID:17942748 Ghitm Mouse 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of GHITM mRNA CTD PMID:17942748 Ghitm Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of GHITM mRNA CTD PMID:39298647 Ghitm Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of GHITM mRNA and AHR protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of GHITM mRNA] CTD PMID:16214954 and PMID:17942748 Ghitm Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ghitm (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GHITM mRNA CTD PMID:33387578 Ghitm Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GHITM mRNA CTD PMID:21570461 and PMID:24680724 Ghitm Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GHITM mRNA CTD PMID:16214954 Ghitm Mouse 2,3-dimethoxynaphthalene-1,4-dione decreases expression ISO GHITM (Homo sapiens) 6480464 2 more ... CTD PMID:17547211 Ghitm Mouse 2-hydroxypropanoic acid decreases expression ISO GHITM (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GHITM mRNA CTD PMID:30851411 Ghitm Mouse 3-chloropropane-1,2-diol increases expression ISO Ghitm (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of GHITM protein CTD PMID:34915118 Ghitm Mouse 4,4'-sulfonyldiphenol increases expression ISO GHITM (Homo sapiens) 6480464 bisphenol S results in increased expression of GHITM protein CTD PMID:34186270 Ghitm Mouse acetylsalicylic acid increases expression ISO GHITM (Homo sapiens) 6480464 Aspirin results in increased expression of GHITM mRNA CTD PMID:15928584 Ghitm Mouse acrylamide increases expression ISO GHITM (Homo sapiens) 6480464 Acrylamide results in increased expression of GHITM mRNA CTD PMID:32763439 Ghitm Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of GHITM mRNA CTD PMID:19770486 Ghitm Mouse antimony(0) decreases expression ISO GHITM (Homo sapiens) 6480464 Antimony results in decreased expression of GHITM mRNA CTD PMID:17547211 Ghitm Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of GHITM mRNA CTD PMID:23650126 Ghitm Mouse arsane multiple interactions ISO GHITM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GHITM mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GHITM mRNA CTD PMID:39836092 Ghitm Mouse arsenic atom multiple interactions ISO GHITM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GHITM mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GHITM mRNA CTD PMID:39836092 Ghitm Mouse arsenite(3-) multiple interactions ISO GHITM (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to GHITM mRNA] CTD PMID:32406909 Ghitm Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of GHITM mRNA CTD PMID:22228805 Ghitm Mouse benzo[a]pyrene increases methylation ISO GHITM (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GHITM promoter CTD PMID:27901495 Ghitm Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of GHITM mRNA CTD PMID:19850644 Ghitm Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of GHITM mRNA] CTD PMID:19850644 Ghitm Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GHITM mRNA CTD PMID:26063408 Ghitm Mouse bisphenol A increases expression ISO GHITM (Homo sapiens) 6480464 bisphenol A results in increased expression of GHITM protein CTD PMID:37567409 Ghitm Mouse bisphenol A decreases expression ISO GHITM (Homo sapiens) 6480464 bisphenol A results in decreased expression of GHITM protein CTD PMID:34186270 Ghitm Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GHITM mRNA CTD PMID:33221593 Ghitm Mouse bisphenol A affects expression ISO GHITM (Homo sapiens) 6480464 bisphenol A affects the expression of GHITM mRNA CTD PMID:30903817 Ghitm Mouse bisphenol A increases expression ISO Ghitm (Rattus norvegicus) 6480464 bisphenol A results in increased expression of GHITM mRNA CTD PMID:25181051 and PMID:30816183 Ghitm Mouse butanal decreases expression ISO GHITM (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GHITM mRNA CTD PMID:26079696 Ghitm Mouse cadmium atom multiple interactions ISO GHITM (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GHITM mRNA CTD PMID:35301059 Ghitm Mouse cadmium dichloride multiple interactions ISO GHITM (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GHITM mRNA CTD PMID:35301059 Ghitm Mouse caffeine multiple interactions EXP 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ghitm Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of GHITM mRNA CTD PMID:25554681 Ghitm Mouse CGP 52608 multiple interactions ISO GHITM (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GHITM gene] CTD PMID:28238834 Ghitm Mouse chloropicrin affects expression ISO GHITM (Homo sapiens) 6480464 chloropicrin affects the expression of GHITM mRNA CTD PMID:26352163 Ghitm Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GHITM gene CTD PMID:20938992 Ghitm Mouse chromium(6+) multiple interactions ISO GHITM (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of GHITM mRNA CTD PMID:38479592 Ghitm Mouse clozapine increases expression ISO GHITM (Homo sapiens) 6480464 Clozapine results in increased expression of GHITM protein CTD PMID:34122009 Ghitm Mouse cobalt dichloride increases expression ISO Ghitm (Rattus norvegicus) 6480464 cobaltous chloride results in increased expression of GHITM mRNA CTD PMID:24386269 Ghitm Mouse copper atom increases expression EXP 6480464 Copper results in increased expression of GHITM mRNA CTD PMID:16629173 Ghitm Mouse copper(0) increases expression EXP 6480464 Copper results in increased expression of GHITM mRNA CTD PMID:16629173 Ghitm Mouse copper(II) sulfate increases expression ISO GHITM (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GHITM mRNA CTD PMID:19549813 Ghitm Mouse cyclosporin A increases expression ISO GHITM (Homo sapiens) 6480464 Cyclosporine results in increased expression of GHITM mRNA CTD PMID:25562108 Ghitm Mouse dibenzo[a,l]pyrene decreases expression EXP 6480464 dibenzo(a and l)pyrene results in decreased expression of GHITM mRNA CTD PMID:25908611 Ghitm Mouse dibutyl phthalate decreases expression ISO Ghitm (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of GHITM mRNA CTD PMID:21266533 Ghitm Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of GHITM mRNA CTD PMID:21266533 Ghitm Mouse dicrotophos decreases expression ISO GHITM (Homo sapiens) 6480464 dicrotophos results in decreased expression of GHITM mRNA CTD PMID:28302478 Ghitm Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of GHITM mRNA CTD PMID:22629407 Ghitm Mouse dioxygen multiple interactions EXP 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of GHITM mRNA] CTD PMID:22629407 Ghitm Mouse dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate decreases expression ISO GHITM (Homo sapiens) 6480464 Antimony Potassium Tartrate results in decreased expression of GHITM mRNA CTD PMID:17547211 Ghitm Mouse doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of GHITM mRNA CTD PMID:26873546 Ghitm Mouse doxorubicin increases expression ISO GHITM (Homo sapiens) 6480464 Doxorubicin results in increased expression of GHITM mRNA CTD PMID:29803840 Ghitm Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of GHITM mRNA CTD PMID:30319688 Ghitm Mouse finasteride increases expression ISO Ghitm (Rattus norvegicus) 6480464 Finasteride results in increased expression of GHITM mRNA CTD PMID:24136188 Ghitm Mouse fipronil increases expression ISO Ghitm (Rattus norvegicus) 6480464 fipronil results in increased expression of GHITM mRNA CTD PMID:23962444 Ghitm Mouse flutamide increases expression ISO Ghitm (Rattus norvegicus) 6480464 Flutamide results in increased expression of GHITM mRNA CTD PMID:24136188 Ghitm Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ghitm Mouse gentamycin increases expression ISO Ghitm (Rattus norvegicus) 6480464 Gentamicins results in increased expression of GHITM mRNA CTD PMID:33387578 Ghitm Mouse glyphosate affects methylation ISO Ghitm (Rattus norvegicus) 6480464 Glyphosate affects the methylation of GHITM gene CTD PMID:35440735 Ghitm Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GHITM mRNA CTD PMID:36331819 Ghitm Mouse isotretinoin decreases expression ISO GHITM (Homo sapiens) 6480464 Isotretinoin results in decreased expression of GHITM mRNA CTD PMID:20436886 Ghitm Mouse ivermectin decreases expression ISO GHITM (Homo sapiens) 6480464 Ivermectin results in decreased expression of GHITM protein CTD PMID:32959892 Ghitm Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GHITM gene CTD PMID:20938992 Ghitm Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of GHITM mRNA CTD PMID:25270620 Ghitm Mouse leflunomide increases expression ISO Ghitm (Rattus norvegicus) 6480464 leflunomide results in increased expression of GHITM mRNA CTD PMID:24136188 Ghitm Mouse manganese atom multiple interactions ISO GHITM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GHITM mRNA CTD PMID:39836092 Ghitm Mouse manganese(0) multiple interactions ISO GHITM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GHITM mRNA CTD PMID:39836092 Ghitm Mouse manganese(II) chloride multiple interactions ISO GHITM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GHITM mRNA CTD PMID:39836092 Ghitm Mouse methapyrilene decreases expression ISO Ghitm (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of GHITM mRNA CTD PMID:30467583 Ghitm Mouse N,N-diethyl-m-toluamide multiple interactions ISO Ghitm (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GHITM gene CTD PMID:33148267 Ghitm Mouse N-methyl-4-phenylpyridinium increases expression ISO Ghitm (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of GHITM mRNA CTD PMID:28801915 Ghitm Mouse nefazodone increases expression ISO Ghitm (Rattus norvegicus) 6480464 nefazodone results in increased expression of GHITM mRNA CTD PMID:24136188 Ghitm Mouse nicotine multiple interactions EXP 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Ghitm Mouse nimesulide increases expression ISO Ghitm (Rattus norvegicus) 6480464 nimesulide results in increased expression of GHITM mRNA CTD PMID:24136188 Ghitm Mouse ozone multiple interactions ISO GHITM (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GHITM mRNA CTD PMID:35430440 Ghitm Mouse paracetamol increases expression ISO Ghitm (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of GHITM mRNA CTD PMID:33387578 Ghitm Mouse paraquat increases expression ISO Ghitm (Rattus norvegicus) 6480464 Paraquat results in increased expression of GHITM mRNA CTD PMID:32680482 Ghitm Mouse pentane-2,3-dione decreases expression ISO Ghitm (Rattus norvegicus) 6480464 2 and 3-pentanedione results in decreased expression of GHITM mRNA CTD PMID:25710175 Ghitm Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GHITM mRNA more ... CTD PMID:36331819 Ghitm Mouse perfluorooctane-1-sulfonic acid increases expression ISO GHITM (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of GHITM mRNA CTD PMID:25812627 Ghitm Mouse perfluorooctanoic acid increases expression ISO GHITM (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of GHITM mRNA CTD PMID:25812627 Ghitm Mouse permethrin multiple interactions ISO Ghitm (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GHITM gene CTD PMID:33148267 Ghitm Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of GHITM mRNA CTD PMID:18301758 and PMID:23811191 Ghitm Mouse rac-lactic acid decreases expression ISO GHITM (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GHITM mRNA CTD PMID:30851411 Ghitm Mouse resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of GHITM protein CTD PMID:25505154 Ghitm Mouse sodium arsenite increases expression ISO GHITM (Homo sapiens) 6480464 sodium arsenite results in increased expression of GHITM mRNA CTD PMID:38568856 Ghitm Mouse sodium arsenite multiple interactions ISO GHITM (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GHITM mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GHITM mRNA CTD PMID:39836092 Ghitm Mouse sulindac increases expression ISO Ghitm (Rattus norvegicus) 6480464 Sulindac results in increased expression of GHITM mRNA CTD PMID:24136188 Ghitm Mouse sunitinib increases expression ISO GHITM (Homo sapiens) 6480464 Sunitinib results in increased expression of GHITM mRNA CTD PMID:31533062 Ghitm Mouse T-2 toxin decreases expression ISO Ghitm (Rattus norvegicus) 6480464 T-2 Toxin results in decreased expression of GHITM mRNA CTD PMID:26141394 Ghitm Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of GHITM mRNA CTD PMID:17555576 Ghitm Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of GHITM promoter CTD PMID:35295148 Ghitm Mouse trichloroethene increases expression ISO Ghitm (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of GHITM mRNA CTD PMID:33387578 Ghitm Mouse triphenyl phosphate affects expression ISO GHITM (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GHITM mRNA CTD PMID:37042841 Ghitm Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of GHITM mRNA CTD PMID:33045310 Ghitm Mouse tunicamycin increases expression ISO GHITM (Homo sapiens) 6480464 Tunicamycin results in increased expression of GHITM mRNA CTD PMID:22378314 Ghitm Mouse valproic acid increases methylation ISO GHITM (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GHITM gene CTD PMID:29154799 Ghitm Mouse vinclozolin increases expression ISO Ghitm (Rattus norvegicus) 6480464 vinclozolin results in increased expression of GHITM mRNA CTD PMID:23034163
(1->4)-beta-D-glucan (EXP) (S)-nicotine (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (ISO) acetylsalicylic acid (ISO) acrylamide (ISO) aflatoxin B1 (EXP) antimony(0) (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (EXP) carbon nanotube (EXP) CGP 52608 (ISO) chloropicrin (ISO) choline (EXP) chromium(6+) (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) dibenzo[a,l]pyrene (EXP) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) dioxygen (EXP) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) doxorubicin (EXP,ISO) ethanol (EXP) finasteride (ISO) fipronil (ISO) flutamide (ISO) folic acid (EXP) gentamycin (ISO) glyphosate (ISO) inulin (EXP) isotretinoin (ISO) ivermectin (ISO) L-methionine (EXP) lead diacetate (EXP) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) N,N-diethyl-m-toluamide (ISO) N-methyl-4-phenylpyridinium (ISO) nefazodone (ISO) nicotine (EXP) nimesulide (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) pentane-2,3-dione (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (ISO) pirinixic acid (EXP) rac-lactic acid (ISO) resveratrol (EXP) sodium arsenite (ISO) sulindac (ISO) sunitinib (ISO) T-2 toxin (ISO) tamoxifen (EXP) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (EXP) tunicamycin (ISO) valproic acid (ISO) vinclozolin (ISO)
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
3.
Identification, isolation, and cloning of growth hormone (GH)-inducible interscapular brown adipose complementary deoxyribonucleic acid from GH antagonist mice.
Li Y, etal., Endocrinology 2001 Jul;142(7):2937-45.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Ghitm Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 36,842,401 - 36,857,279 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 36,842,049 - 36,857,229 (-) Ensembl GRCm39 Ensembl GRCm38 14 37,120,444 - 37,135,322 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 37,120,092 - 37,135,272 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 37,934,004 - 37,948,452 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 36,032,558 - 36,047,006 (-) NCBI MGSCv36 mm8 Celera 14 33,331,790 - 33,346,360 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 21.29 NCBI
GHITM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 84,139,509 - 84,153,568 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 84,139,482 - 84,154,841 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 85,899,265 - 85,913,324 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 85,889,165 - 85,903,291 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 85,889,237 - 85,903,291 NCBI Celera 10 79,894,096 - 79,908,234 (+) NCBI Celera Cytogenetic Map 10 q23.1 NCBI HuRef 10 79,745,159 - 79,759,301 (+) NCBI HuRef CHM1_1 10 86,180,946 - 86,195,083 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 85,017,654 - 85,031,724 (+) NCBI T2T-CHM13v2.0
Ghitm Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 12,907,062 - 12,918,149 (-) NCBI GRCr8 mRatBN7.2 16 12,885,551 - 12,897,887 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 12,885,553 - 12,897,879 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 12,831,674 - 12,842,769 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 13,976,415 - 13,987,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 12,824,172 - 12,835,267 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 14,370,269 - 14,382,647 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 14,371,531 - 14,382,641 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 14,272,787 - 14,285,160 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 13,327,337 - 13,338,420 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 13,327,335 - 13,338,418 (-) NCBI Celera 16 13,144,969 - 13,156,052 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
Ghitm Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955510 3,674,303 - 3,689,449 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955510 3,674,303 - 3,688,747 (+) NCBI ChiLan1.0 ChiLan1.0
GHITM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 96,117,764 - 96,133,798 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 96,123,812 - 96,139,118 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 80,553,711 - 80,567,426 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 84,123,467 - 84,137,219 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 84,123,467 - 84,137,219 (+) Ensembl panpan1.1 panPan2
GHITM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 32,402,210 - 32,417,905 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 32,402,299 - 32,416,816 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 32,387,947 - 32,403,594 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 32,717,915 - 32,733,649 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 32,718,015 - 32,742,217 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 32,580,655 - 32,596,363 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 32,772,867 - 32,788,570 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 33,269,168 - 33,285,122 (+) NCBI UU_Cfam_GSD_1.0
Ghitm
GHITM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 85,385,868 - 85,401,670 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 85,385,578 - 85,401,680 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 92,190,430 - 92,206,533 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GHITM Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 47,683,075 - 47,697,855 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 47,679,764 - 47,697,834 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 7,859,971 - 7,874,658 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ghitm
.
Predicted Target Of
Count of predictions: 902 Count of miRNA genes: 340 Interacting mature miRNAs: 372 Transcripts: ENSMUST00000042564, ENSMUST00000165649 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 1300625 Cosz2_m cocaine seizure 2 (mouse) Not determined 14 35045797 68785736 Mouse 27226748 Femd8_m femur midshaft diameter 8, 10 week (mouse) 14 13769273 46737457 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 27226744 Metcl6_m metatarsal-calcaneal length 6, 5 week (mouse) 14 30321957 52937457 Mouse 27226775 Tibl7_m tibia length 7, 5 week (mouse) 14 30321957 48837457 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 4142485 Modor2_m modifier of ocular retardation 2 (mouse) Not determined 14 24926248 58179769 Mouse 27226737 Metcl12_m metatarsal-calcaneal length 12, 10 week (mouse) 14 33221957 59437449 Mouse 1301372 Sluc13_m susceptibility to lung cancer 13 (mouse) Not determined 14 18827604 52827726 Mouse 4141550 Dbm3_m diabetes modifier 3 (mouse) Not determined 5143473 39143596 Mouse 1300544 Hypn_m hyperinsulinemia (mouse) Not determined 14 15160616 49160765 Mouse 1301991 Wta3_m weight adult 3 (mouse) Not determined 14 3887473 37887650 Mouse 1300998 Cia17_m collagen induced arthritis 17 (mouse) Not determined 14 30335250 64335381 Mouse 4141864 Mrdq4_m modifier of retinal degeneration QTL 4 (mouse) Not determined 9923245 48765082 Mouse 10043886 Cia49_m collagen induced arthritis QTL 49 (mouse) Not determined 14 29996994 63997133 Mouse 1300779 Dyscalc4_m dystrophic cardiac calcinosis 4 (mouse) Not determined 14 12212871 46213007 Mouse 27226727 Tibl21_m tibia length 21, 16 week (mouse) 14 34121957 52937457 Mouse 14746973 Manh76_m mandible shape 76 (mouse) 14 22287217 56287217 Mouse 1300909 Ath13_m atherosclerosis 13 (mouse) Not determined 14 30335250 64335381 Mouse 27226752 Femd4_m femur midshaft diameter 4, 5 week (mouse) 14 13769273 47237457 Mouse 13506929 Recrq10_m recombination rate in male meiosis QTL 10 (mouse) 14 27921957 61137449 Mouse
RH126253
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 37,121,967 - 37,122,208 UniSTS GRCm38 MGSCv37 14 37,935,153 - 37,935,394 UniSTS GRCm37 Celera 14 33,332,939 - 33,333,180 UniSTS Cytogenetic Map 14 B UniSTS cM Map 14 15.0 UniSTS
AA799642
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 37,125,156 - 37,125,281 UniSTS GRCm38 MGSCv37 14 37,938,342 - 37,938,467 UniSTS GRCm37 Celera 14 33,336,250 - 33,336,375 UniSTS Cytogenetic Map 14 B UniSTS cM Map 14 15.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000042564 ⟹ ENSMUSP00000046212
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 36,842,781 - 36,857,096 (-) Ensembl GRCm38.p6 Ensembl 14 37,120,824 - 37,135,139 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000165649 ⟹ ENSMUSP00000129712
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 36,842,049 - 36,857,209 (-) Ensembl GRCm38.p6 Ensembl 14 37,120,092 - 37,135,252 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000223921
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 36,853,355 - 36,857,229 (-) Ensembl GRCm38.p6 Ensembl 14 37,131,398 - 37,135,272 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000224769 ⟹ ENSMUSP00000153458
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 36,849,544 - 36,857,211 (-) Ensembl GRCm38.p6 Ensembl 14 37,127,587 - 37,135,254 (-) Ensembl
RefSeq Acc Id:
NM_001199122 ⟹ NP_001186051
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 36,842,401 - 36,857,096 (-) NCBI GRCm38 14 37,120,444 - 37,135,139 (-) NCBI Celera 14 33,331,416 - 33,346,416 (-) ENTREZGENE cM Map 14 ENTREZGENE
Sequence:
GGGATCTGGGCTGGCTGCTACGGGCGGGGCGGGAAGGCCGGGCTCGTCCTCGCTCTTCATCTCCCTGGGCAGAGGGATGCTGAGTCAGCCGCTCGGGGACCCGCGCGGGGGCCCTAGCTGTCGGCGAT
hide sequence
RefSeq Acc Id:
NM_001359902 ⟹ NP_001346831
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 36,842,401 - 36,857,211 (-) NCBI GRCm38 14 37,120,444 - 37,135,254 (-) NCBI
Sequence:
CACACTCTGAGTTTCGGTGACCCGGAAGGGAGCCCCGTGGTAGAGGTGACCGGAGCTGAGGTAC
hide sequence
RefSeq Acc Id:
NM_078478 ⟹ NP_510963
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 36,842,401 - 36,857,279 (-) NCBI GRCm38 14 37,120,444 - 37,135,322 (-) NCBI MGSCv37 14 37,934,004 - 37,948,452 (-) RGD Celera 14 33,331,416 - 33,346,416 (-) ENTREZGENE cM Map 14 ENTREZGENE
Sequence:
CCTTTTGTCCGGATATTGCGTGACGCTGTGAGTCGCGCGGTTGCGGAGGAGCGGGCAGAGGGAGGTCGCACACTCTGAGTTTCGGTGACCCGGAAGGGAGCCCCGTGGTAGAGGTGACCGGAGCTGAG
hide sequence
RefSeq Acc Id:
NP_510963 ⟸ NM_078478
- UniProtKB:
Q3UA74 (UniProtKB/Swiss-Prot), Q3TGB7 (UniProtKB/Swiss-Prot), Q8N9T5 (UniProtKB/Swiss-Prot), Q91VC9 (UniProtKB/Swiss-Prot)
- Sequence:
MLAARLVCLRTLPSRVFQPTFITKASPLVKNSITKNQWLVTPSREYATKTRIRTHRGKTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNEIGAIEKAVIWPQYVKDRIHST
hide sequence
RefSeq Acc Id:
NP_001186051 ⟸ NM_001199122
- UniProtKB:
Q3UA74 (UniProtKB/Swiss-Prot), Q3TGB7 (UniProtKB/Swiss-Prot), Q8N9T5 (UniProtKB/Swiss-Prot), Q91VC9 (UniProtKB/Swiss-Prot)
- Sequence:
MLAARLVCLRTLPSRVFQPTFITKASPLVKNSITKNQWLVTPSREYATKTRIRTHRGKTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNEIGAIEKAVIWPQYVKDRIHST
hide sequence
RefSeq Acc Id:
NP_001346831 ⟸ NM_001359902
- UniProtKB:
Q91VC9 (UniProtKB/Swiss-Prot), Q3UA74 (UniProtKB/Swiss-Prot), Q3TGB7 (UniProtKB/Swiss-Prot), Q8N9T5 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000129712 ⟸ ENSMUST00000165649
Ensembl Acc Id:
ENSMUSP00000153458 ⟸ ENSMUST00000224769
Ensembl Acc Id:
ENSMUSP00000046212 ⟸ ENSMUST00000042564
RGD ID: 8681964 Promoter ID: EPDNEW_M19013 Type: initiation region Name: Ghitm_2 Description: Mus musculus growth hormone inducible transmembrane protein ,transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M19014 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 37,135,166 - 37,135,226 EPDNEW
RGD ID: 8681966 Promoter ID: EPDNEW_M19014 Type: initiation region Name: Ghitm_1 Description: Mus musculus growth hormone inducible transmembrane protein ,transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M19013 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 37,135,298 - 37,135,358 EPDNEW
RGD ID: 6824951 Promoter ID: MM_KWN:16243 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000042564, UC007TBX.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 37,947,996 - 37,948,752 (-) MPROMDB
