Symbol:
Lpgat1
Name:
lysophosphatidylglycerol acyltransferase 1
RGD ID:
1551029
MGI Page
MGI
Description:
Enables 2-acylglycerol O-acyltransferase activity; 2-acylglycerophosphocholine O-acyltransferase activity; and lysophosphatidylethanolamine acyltransferase activity. Involved in phosphatidylethanolamine acyl-chain remodeling and triglyceride biosynthetic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in endoplasmic reticulum. Is expressed in nervous system; nose; respiratory system; salivary gland; and urinary system. Orthologous to human LPGAT1 (lysophosphatidylglycerol acyltransferase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2-acylglycerophosphocholine O-acyltransferase; acyl-CoA:lysophosphatidylglycerol acyltransferase 1; acyl-CoA:monoacylglycerol acyltransferase LPGAT1; AI649174; AW112037; BC013667; expressed sequence AW112037; KIAA0205; LPLAT7; lysophospholipid acyltransferase 7; MGC18768; stearoyl-CoA:1-lyso-2-acyl-PE acyltransferase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LPGAT1 (lysophosphatidylglycerol acyltransferase 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Lpgat1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lpgat1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LPGAT1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LPGAT1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lpgat1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LPGAT1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LPGAT1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lpgat1 (lysophosphatidylglycerol acyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
LPGAT1 (lysophosphatidylglycerol acyltransferase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Lpgat1l1 (lysophosphatidylglycerol acyltransferase 1 like 1)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Rattus norvegicus (Norway rat):
Lpgat1 (lysophosphatidylglycerol acyltransferase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lpgat1 (lysophosphatidylglycerol acyltransferase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
acl-14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lpgat1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 191,449,682 - 191,516,367 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 191,449,946 - 191,516,367 (+) Ensembl GRCm39 Ensembl GRCm38 1 191,717,554 - 191,784,255 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 191,717,834 - 191,784,255 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 193,541,903 - 193,608,134 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 193,419,112 - 193,479,245 (+) NCBI MGSCv36 mm8 Celera 1 198,669,571 - 198,735,196 (+) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 96.78 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lpgat1 Mouse (+)-schisandrin B multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of LPGAT1 mRNA] CTD PMID:31150632 Lpgat1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LPGAT1 mRNA CTD PMID:36331819 Lpgat1 Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of LPGAT1 mRNA CTD PMID:28960355 Lpgat1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of LPGAT1 mRNA CTD PMID:22206623 Lpgat1 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LPGAT1 mRNA CTD PMID:17942748 Lpgat1 Mouse 17alpha-ethynylestradiol increases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of LPGAT1 mRNA CTD PMID:29097150 Lpgat1 Mouse 17beta-estradiol decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Estradiol results in decreased expression of LPGAT1 mRNA CTD PMID:21185374 Lpgat1 Mouse 17beta-estradiol decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of LPGAT1 mRNA CTD PMID:32145629 Lpgat1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of LPGAT1 mRNA CTD PMID:19484750 Lpgat1 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Lpgat1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LPGAT1 mRNA CTD PMID:17101203 Lpgat1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lpgat1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of LPGAT1 mRNA CTD PMID:34747641 Lpgat1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LPGAT1 mRNA CTD PMID:32109520 and PMID:33387578 Lpgat1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LPGAT1 mRNA CTD PMID:21570461 Lpgat1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LPGAT1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LPGAT1 mRNA CTD PMID:20106945 and PMID:21632981 Lpgat1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:17942748 and PMID:28433925 Lpgat1 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 tetrabromobisphenol A results in decreased expression of LPGAT1 mRNA CTD PMID:27914987 Lpgat1 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of LPGAT1 mRNA CTD PMID:26251327 Lpgat1 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of LPGAT1 mRNA CTD PMID:28628672 Lpgat1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of LPGAT1 mRNA CTD PMID:39298647 Lpgat1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of LPGAT1 mRNA CTD PMID:36041667 Lpgat1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of LPGAT1 mRNA CTD PMID:28973697 Lpgat1 Mouse acetamide decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of LPGAT1 mRNA CTD PMID:31881176 Lpgat1 Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of LPGAT1 mRNA CTD PMID:19770486 Lpgat1 Mouse aflatoxin B1 decreases methylation ISO LPGAT1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of LPGAT1 gene CTD PMID:27153756 Lpgat1 Mouse all-trans-retinoic acid increases expression ISO LPGAT1 (Homo sapiens) 6480464 Tretinoin results in increased expression of LPGAT1 mRNA CTD PMID:21934132 Lpgat1 Mouse amiodarone increases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Amiodarone results in increased expression of LPGAT1 mRNA CTD PMID:22291062 Lpgat1 Mouse aristolochic acid A decreases expression ISO LPGAT1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of LPGAT1 mRNA CTD PMID:33212167 Lpgat1 Mouse arsane multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LPGAT1 mRNA CTD PMID:39836092 Lpgat1 Mouse arsenic atom multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LPGAT1 mRNA CTD PMID:39836092 Lpgat1 Mouse azoxystrobin multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LPGAT1 gene CTD PMID:33854195 Lpgat1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of LPGAT1 mRNA CTD PMID:19770486 Lpgat1 Mouse benzo[a]pyrene affects methylation ISO LPGAT1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LPGAT1 5' UTR CTD PMID:27901495 Lpgat1 Mouse benzo[a]pyrene decreases methylation ISO LPGAT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of LPGAT1 3' UTR CTD PMID:27901495 Lpgat1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO LPGAT1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Lpgat1 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Lpgat1 Mouse bisphenol A increases expression ISO LPGAT1 (Homo sapiens) 6480464 bisphenol A results in increased expression of LPGAT1 mRNA CTD PMID:25047013 Lpgat1 Mouse bisphenol A multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of LPGAT1 mRNA CTD PMID:36041667 Lpgat1 Mouse bisphenol A multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of LPGAT1 gene CTD PMID:31601247 Lpgat1 Mouse bisphenol A decreases methylation ISO LPGAT1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of LPGAT1 gene CTD PMID:31601247 Lpgat1 Mouse bisphenol A multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Lpgat1 Mouse bisphenol A increases expression ISO Lpgat1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of LPGAT1 mRNA CTD PMID:29097150 Lpgat1 Mouse bisphenol A increases methylation ISO Lpgat1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of LPGAT1 gene CTD PMID:28505145 Lpgat1 Mouse bisphenol A affects expression ISO Lpgat1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of LPGAT1 mRNA CTD PMID:25181051 and PMID:32145629 Lpgat1 Mouse bisphenol F multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of LPGAT1 mRNA CTD PMID:28628672 Lpgat1 Mouse bisphenol F multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of LPGAT1 mRNA CTD PMID:36041667 Lpgat1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of LPGAT1 mRNA CTD PMID:38685157 Lpgat1 Mouse calcitriol increases expression ISO LPGAT1 (Homo sapiens) 6480464 Calcitriol results in increased expression of LPGAT1 mRNA CTD PMID:16002434 Lpgat1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon analog results in decreased expression of LPGAT1 mRNA CTD PMID:25554681 Lpgat1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25620056 Lpgat1 Mouse CGP 52608 multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LPGAT1 gene] CTD PMID:28238834 Lpgat1 Mouse chloroprene increases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Chloroprene results in increased expression of LPGAT1 mRNA CTD PMID:23125180 Lpgat1 Mouse chlorpyrifos multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LPGAT1 gene CTD PMID:33854195 Lpgat1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of LPGAT1 mRNA CTD PMID:32715474 Lpgat1 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of LPGAT1 mRNA CTD PMID:28472532 Lpgat1 Mouse cisplatin increases expression ISO LPGAT1 (Homo sapiens) 6480464 Cisplatin results in increased expression of LPGAT1 mRNA CTD PMID:27594783 Lpgat1 Mouse cyclosporin A decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LPGAT1 mRNA CTD PMID:20106945 more ... Lpgat1 Mouse dexamethasone multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of LPGAT1 mRNA CTD PMID:28628672 Lpgat1 Mouse dorsomorphin multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lpgat1 Mouse endosulfan decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of LPGAT1 mRNA CTD PMID:29391264 Lpgat1 Mouse entinostat increases expression ISO LPGAT1 (Homo sapiens) 6480464 entinostat results in increased expression of LPGAT1 mRNA CTD PMID:26272509 Lpgat1 Mouse entinostat multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LPGAT1 mRNA CTD PMID:27188386 Lpgat1 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of LPGAT1 mRNA CTD PMID:30319688 Lpgat1 Mouse folpet decreases expression EXP 6480464 folpet results in decreased expression of LPGAT1 mRNA CTD PMID:31558096 Lpgat1 Mouse formaldehyde decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of LPGAT1 mRNA CTD PMID:23649840 Lpgat1 Mouse fulvestrant multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of LPGAT1 gene CTD PMID:31601247 Lpgat1 Mouse furan decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 furan results in decreased expression of LPGAT1 mRNA CTD PMID:25539665 more ... Lpgat1 Mouse gentamycin decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of LPGAT1 mRNA CTD PMID:33387578 Lpgat1 Mouse glafenine decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of LPGAT1 mRNA CTD PMID:24136188 Lpgat1 Mouse glyphosate multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LPGAT1 gene CTD PMID:33854195 Lpgat1 Mouse gold atom multiple interactions EXP 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of LPGAT1 mRNA CTD PMID:19695318 Lpgat1 Mouse gold(0) multiple interactions EXP 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of LPGAT1 mRNA CTD PMID:19695318 Lpgat1 Mouse hydralazine multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of LPGAT1 mRNA CTD PMID:17183730 Lpgat1 Mouse hydrogen cyanide increases expression EXP 6480464 Hydrogen Cyanide results in increased expression of LPGAT1 mRNA CTD PMID:33914522 Lpgat1 Mouse hydrogen peroxide affects expression ISO LPGAT1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of LPGAT1 mRNA CTD PMID:20044591 Lpgat1 Mouse imidacloprid multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LPGAT1 gene CTD PMID:33854195 Lpgat1 Mouse indometacin multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of LPGAT1 mRNA CTD PMID:28628672 Lpgat1 Mouse lipopolysaccharide multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with resveratrol] results in decreased expression of LPGAT1 mRNA CTD PMID:26667767 Lpgat1 Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of LPGAT1 mRNA CTD PMID:27339419 Lpgat1 Mouse manganese atom multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LPGAT1 mRNA CTD PMID:39836092 Lpgat1 Mouse manganese(0) multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LPGAT1 mRNA CTD PMID:39836092 Lpgat1 Mouse manganese(II) chloride multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LPGAT1 mRNA CTD PMID:39836092 Lpgat1 Mouse mercury dichloride decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of LPGAT1 mRNA CTD PMID:27188386 Lpgat1 Mouse methoxychlor affects methylation ISO Lpgat1 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of LPGAT1 gene CTD PMID:35440735 Lpgat1 Mouse methyl methanesulfonate decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of LPGAT1 mRNA CTD PMID:23649840 Lpgat1 Mouse methylmercury chloride decreases expression ISO LPGAT1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of LPGAT1 mRNA CTD PMID:23179753 more ... Lpgat1 Mouse methylmercury chloride multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LPGAT1 mRNA CTD PMID:27188386 Lpgat1 Mouse nickel atom increases expression ISO LPGAT1 (Homo sapiens) 6480464 Nickel results in increased expression of LPGAT1 mRNA CTD PMID:24768652 Lpgat1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of LPGAT1 mRNA CTD PMID:17562736 Lpgat1 Mouse paracetamol decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of LPGAT1 mRNA CTD PMID:33387578 Lpgat1 Mouse paracetamol decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of LPGAT1 mRNA CTD PMID:21420995 Lpgat1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LPGAT1 mRNA CTD PMID:36331819 Lpgat1 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of LPGAT1 mRNA CTD PMID:23091169 Lpgat1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of LPGAT1 mRNA CTD PMID:18301758 and PMID:18445702 Lpgat1 Mouse potassium cyanide increases expression EXP 6480464 Potassium Cyanide results in increased expression of LPGAT1 mRNA CTD PMID:33914522 Lpgat1 Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of LPGAT1 mRNA CTD PMID:28903501 Lpgat1 Mouse quercetin decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Quercetin results in decreased expression of LPGAT1 mRNA CTD PMID:21632981 Lpgat1 Mouse resveratrol multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Resveratrol] results in decreased expression of LPGAT1 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of LPGAT1 mRNA CTD PMID:23557933 and PMID:26667767 Lpgat1 Mouse rimonabant affects expression EXP 6480464 Rimonabant affects the expression of LPGAT1 mRNA CTD PMID:19030233 Lpgat1 Mouse SB 431542 multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lpgat1 Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of LPGAT1 mRNA CTD PMID:21795629 Lpgat1 Mouse sodium arsenite increases expression ISO LPGAT1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of LPGAT1 mRNA CTD PMID:38568856 Lpgat1 Mouse sodium arsenite multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LPGAT1 mRNA CTD PMID:39836092 Lpgat1 Mouse tetrachloromethane decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of LPGAT1 mRNA CTD PMID:31150632 Lpgat1 Mouse tetrachloromethane multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of LPGAT1 mRNA] CTD PMID:31150632 Lpgat1 Mouse thiabendazole multiple interactions ISO Lpgat1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LPGAT1 gene CTD PMID:33854195 Lpgat1 Mouse thimerosal decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of LPGAT1 mRNA CTD PMID:27188386 Lpgat1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of LPGAT1 promoter CTD PMID:35295148 Lpgat1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of LPGAT1 gene CTD PMID:35295148 Lpgat1 Mouse trichloroethene decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of LPGAT1 mRNA CTD PMID:33387578 Lpgat1 Mouse trichostatin A increases expression ISO LPGAT1 (Homo sapiens) 6480464 trichostatin A results in increased expression of LPGAT1 mRNA CTD PMID:24935251 and PMID:26272509 Lpgat1 Mouse triphenyl phosphate affects expression ISO LPGAT1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LPGAT1 mRNA CTD PMID:37042841 Lpgat1 Mouse urethane decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Urethane results in decreased expression of LPGAT1 mRNA CTD PMID:28818685 Lpgat1 Mouse valproic acid decreases methylation ISO LPGAT1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of LPGAT1 gene CTD PMID:29154799 Lpgat1 Mouse valproic acid decreases expression ISO LPGAT1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of LPGAT1 mRNA CTD PMID:37505509 Lpgat1 Mouse valproic acid increases expression ISO LPGAT1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LPGAT1 mRNA CTD PMID:23179753 more ... Lpgat1 Mouse valproic acid multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of LPGAT1 mRNA more ... CTD PMID:17183730 and PMID:27188386 Lpgat1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of LPGAT1 mRNA CTD PMID:17292431 Lpgat1 Mouse vinclozolin decreases expression ISO Lpgat1 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of LPGAT1 mRNA CTD PMID:18042343 Lpgat1 Mouse vorinostat multiple interactions ISO LPGAT1 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LPGAT1 mRNA CTD PMID:27188386 Lpgat1 Mouse vorinostat decreases expression ISO LPGAT1 (Homo sapiens) 6480464 vorinostat results in decreased expression of LPGAT1 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP) acetamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) azoxystrobin (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) calcitriol (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chloroprene (ISO) chlorpyrifos (EXP,ISO) chromium(6+) (EXP) cisplatin (ISO) cyclosporin A (ISO) dexamethasone (ISO) dorsomorphin (ISO) endosulfan (ISO) entinostat (ISO) ethanol (EXP) folpet (EXP) formaldehyde (ISO) fulvestrant (ISO) furan (ISO) gentamycin (ISO) glafenine (ISO) glyphosate (ISO) gold atom (EXP) gold(0) (EXP) hydralazine (ISO) hydrogen cyanide (EXP) hydrogen peroxide (ISO) imidacloprid (ISO) indometacin (ISO) lipopolysaccharide (EXP,ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) methoxychlor (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) nickel atom (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) pirinixic acid (EXP) potassium cyanide (EXP) pregnenolone 16alpha-carbonitrile (EXP) quercetin (ISO) resveratrol (ISO) rimonabant (EXP) SB 431542 (ISO) sodium arsenate (EXP) sodium arsenite (ISO) tetrachloromethane (ISO) thiabendazole (ISO) thimerosal (ISO) titanium dioxide (EXP) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vorinostat (ISO)
Lpgat1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 191,449,682 - 191,516,367 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 191,449,946 - 191,516,367 (+) Ensembl GRCm39 Ensembl GRCm38 1 191,717,554 - 191,784,255 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 191,717,834 - 191,784,255 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 193,541,903 - 193,608,134 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 193,419,112 - 193,479,245 (+) NCBI MGSCv36 mm8 Celera 1 198,669,571 - 198,735,196 (+) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 96.78 NCBI
LPGAT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 211,743,457 - 211,830,763 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 211,743,457 - 211,830,763 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 211,916,799 - 212,004,105 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 209,984,952 - 210,070,737 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 208,306,723 - 208,392,509 NCBI Celera 1 185,143,875 - 185,229,750 (-) NCBI Celera Cytogenetic Map 1 q32.3 NCBI HuRef 1 182,594,012 - 182,681,317 (-) NCBI HuRef CHM1_1 1 213,189,206 - 213,276,528 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 210,989,592 - 211,076,889 (-) NCBI T2T-CHM13v2.0
Lpgat1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 105,825,630 - 105,896,366 (+) NCBI GRCr8 mRatBN7.2 13 103,294,622 - 103,365,372 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 103,294,528 - 103,362,333 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 105,815,783 - 105,882,272 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 107,199,634 - 107,266,125 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 104,414,724 - 104,481,221 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 110,397,353 - 110,470,874 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 110,398,800 - 110,467,834 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 114,962,169 - 115,028,639 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 107,782,231 - 107,851,353 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 102,735,511 - 102,802,662 (+) NCBI Celera Cytogenetic Map 13 q27 NCBI
Lpgat1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 5,441,316 - 5,522,546 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 5,441,923 - 5,506,575 (+) NCBI ChiLan1.0 ChiLan1.0
LPGAT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 37,571,917 - 37,660,410 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 37,536,420 - 37,624,903 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 187,312,071 - 187,399,145 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 192,172,723 - 192,262,799 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 192,179,164 - 192,262,799 (-) Ensembl panpan1.1 panPan2
LPGAT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 10,091,628 - 10,205,388 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 10,094,069 - 10,198,309 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 9,669,275 - 9,783,091 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 9,797,952 - 9,879,441 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 9,795,669 - 9,890,585 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 9,720,389 - 9,801,756 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 9,822,810 - 9,904,226 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 9,947,369 - 10,029,077 (-) NCBI UU_Cfam_GSD_1.0
Lpgat1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 64,316,244 - 64,387,197 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936557 1,556,526 - 1,621,456 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936557 1,520,692 - 1,627,479 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LPGAT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 131,426,119 - 131,504,473 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 131,383,684 - 131,505,988 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 144,423,367 - 144,543,301 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LPGAT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 17,674,441 - 17,767,522 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 17,675,115 - 17,762,606 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 18,197,582 - 18,292,914 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lpgat1
.
Predicted Target Of
Count of predictions: 2729 Count of miRNA genes: 823 Interacting mature miRNAs: 1144 Transcripts: ENSMUST00000110855, ENSMUST00000110856, ENSMUST00000130876, ENSMUST00000133076, ENSMUST00000138494 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse
AI649174
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 191,779,563 - 191,779,704 UniSTS GRCm38 MGSCv37 1 193,603,442 - 193,603,583 UniSTS GRCm37 Celera 1 198,730,504 - 198,730,645 UniSTS Cytogenetic Map 1 H6 UniSTS Whitehead/MRC_RH 1 2440.83 UniSTS
AW112037
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 191,783,899 - 191,783,999 UniSTS GRCm38 MGSCv37 1 193,607,778 - 193,607,878 UniSTS GRCm37 Celera 1 198,734,840 - 198,734,940 UniSTS Cytogenetic Map 1 H6 UniSTS Whitehead/MRC_RH 1 2440.83 UniSTS
01.MMHAP64FLA1.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 191,726,764 - 191,726,866 UniSTS GRCm38 MGSCv37 1 193,550,643 - 193,550,745 UniSTS GRCm37 Celera 1 198,677,886 - 198,677,988 UniSTS Cytogenetic Map 1 H6 UniSTS Whitehead_YAC 1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000110855 ⟹ ENSMUSP00000106479
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 191,449,946 - 191,516,367 (+) Ensembl GRCm38.p6 Ensembl 1 191,717,834 - 191,784,255 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000110856 ⟹ ENSMUSP00000106480
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 191,450,501 - 191,512,089 (+) Ensembl GRCm38.p6 Ensembl 1 191,718,389 - 191,779,977 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000130876 ⟹ ENSMUSP00000114382
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 191,450,633 - 191,492,296 (+) Ensembl GRCm38.p6 Ensembl 1 191,718,521 - 191,760,184 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133076 ⟹ ENSMUSP00000115255
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 191,449,946 - 191,451,510 (+) Ensembl GRCm38.p6 Ensembl 1 191,717,834 - 191,719,398 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138494
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 191,450,139 - 191,451,898 (+) Ensembl GRCm38.p6 Ensembl 1 191,718,027 - 191,719,786 (+) Ensembl
RefSeq Acc Id:
NM_001134829 ⟹ NP_001128301
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,450,533 - 191,516,367 (+) NCBI GRCm38 1 191,718,395 - 191,784,255 (+) NCBI MGSCv37 1 193,541,903 - 193,608,134 (+) RGD Celera 1 198,669,571 - 198,735,196 (+) RGD cM Map 1 ENTREZGENE
Sequence:
GGCCTCTGAGTCCCCACCGCGCCTCTGTCCGCAGGCAGCCGCGAGGGGACTAGGGCGCCCGCGCGCCCGCTCGCGCCGCGCCTCGGGCCGCCTGGGCCGCCGCAGCCGCGTCCATGACCGCGACCCCC
hide sequence
RefSeq Acc Id:
NM_001421143 ⟹ NP_001408072
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,450,123 - 191,516,367 (+) NCBI
RefSeq Acc Id:
NM_001421144 ⟹ NP_001408073
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,450,533 - 191,516,367 (+) NCBI
RefSeq Acc Id:
NM_001421145 ⟹ NP_001408074
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,450,123 - 191,516,367 (+) NCBI
RefSeq Acc Id:
NM_001421146 ⟹ NP_001408075
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,451,316 - 191,516,367 (+) NCBI
RefSeq Acc Id:
NM_172266 ⟹ NP_758470
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,450,123 - 191,516,367 (+) NCBI GRCm38 1 191,718,024 - 191,784,255 (+) NCBI MGSCv37 1 193,541,903 - 193,608,134 (+) RGD Celera 1 198,669,571 - 198,735,196 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AACCCGCCCCGCCGGCCGGGGCGCACGCAGCCACCGGGCCCTGGGGAGCGAGCGAGTCTCCACG
hide sequence
RefSeq Acc Id:
XM_006497157 ⟹ XP_006497220
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,452,474 - 191,516,367 (+) NCBI GRCm38 1 191,720,345 - 191,783,247 (+) NCBI
Sequence:
TGATCATTTCTTCTTTAGGATTAGAATAATGCAGAAAGGGTGAGGCTTCTAGCACTTGTGAGATGTGGAAACTTTTATTATGGAAACAAAACTGGTGGGCAGATTCCTCAGCAGCTATGCTGCAGTTC
hide sequence
RefSeq Acc Id:
XM_036164249 ⟹ XP_036020142
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,449,682 - 191,510,488 (+) NCBI
Sequence:
AGCGGGATTGAAAATGTTGTCATTCAGGTTTCAGGTGCTTTCCAGAAACAAGAACTCTGGCACTTAAAACAATTGATTTAAAACACTAGACCGTAATGCCTTGGGGAGGTTCAGAAGAAAAGCTCTGA
hide sequence
RefSeq Acc Id:
XM_036164251 ⟹ XP_036020144
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 191,449,818 - 191,510,488 (+) NCBI
Sequence:
GAGTTTCTTTAGGAATGAAAAGGAGAAAGCGTGCCAGCCTGGGGCGGCCAAAGGAGCCGCAACAATGCAGCGCAGCGGCCCTTTTGGCTGAAAGGGGTCCAGGAGGGCCCGAAAGGTCCGCGCGCGCT
hide sequence
RefSeq Acc Id:
NP_758470 ⟸ NM_172266
- Peptide Label:
isoform 2
- UniProtKB:
Q91YX5 (UniProtKB/Swiss-Prot), Q6A0A4 (UniProtKB/TrEMBL)
- Sequence:
MAVTVEEAPWLGWIVAKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGLMYKWLLGMVASWGWYAGYTVMEWGEDIKAIAKDEAVMLVNHQATGDVCTLMMCLQDKGPVVAQMMWLM
hide sequence
RefSeq Acc Id:
NP_001128301 ⟸ NM_001134829
- Peptide Label:
isoform 1
- UniProtKB:
E9QL80 (UniProtKB/TrEMBL), Q6A0A4 (UniProtKB/TrEMBL)
- Sequence:
MTATPGPGTPAAAAAAGPRPCRRSPLAPTEKDRTDANVRMAVTVEEAPWLGWIVAKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGLMYKWLLGMVASWGWYAGYTVMEWGEDIKA
hide sequence
RefSeq Acc Id:
XP_006497220 ⟸ XM_006497157
- Peptide Label:
isoform X5
- UniProtKB:
Q8R1E1 (UniProtKB/TrEMBL)
- Sequence:
MVMEWGEDIKAIAKDEAVMLVNHQATGDVCTLMMCLQDKGPVVAQMMWLMDHIFKYTNFGIVSL
hide sequence
Ensembl Acc Id:
ENSMUSP00000114382 ⟸ ENSMUST00000130876
Ensembl Acc Id:
ENSMUSP00000106479 ⟸ ENSMUST00000110855
Ensembl Acc Id:
ENSMUSP00000106480 ⟸ ENSMUST00000110856
Ensembl Acc Id:
ENSMUSP00000115255 ⟸ ENSMUST00000133076
RefSeq Acc Id:
XP_036020142 ⟸ XM_036164249
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_036020144 ⟸ XM_036164251
- Peptide Label:
isoform X4
RefSeq Acc Id:
NP_001408072 ⟸ NM_001421143
- Peptide Label:
isoform 1
- UniProtKB:
E9QL80 (UniProtKB/TrEMBL), Q6A0A4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408074 ⟸ NM_001421145
- Peptide Label:
isoform 2
- UniProtKB:
Q91YX5 (UniProtKB/Swiss-Prot), Q6A0A4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408073 ⟸ NM_001421144
- Peptide Label:
isoform 2
- UniProtKB:
Q91YX5 (UniProtKB/Swiss-Prot), Q6A0A4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408075 ⟸ NM_001421146
- Peptide Label:
isoform 2
- UniProtKB:
Q91YX5 (UniProtKB/Swiss-Prot), Q6A0A4 (UniProtKB/TrEMBL)
RGD ID: 6876118 Promoter ID: EPDNEW_M1510 Type: multiple initiation site Name: Lpgat1_1 Description: Mus musculus lysophosphatidylglycerol acyltransferase 1 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M1511 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 191,718,421 - 191,718,481 EPDNEW
RGD ID: 6876132 Promoter ID: EPDNEW_M1511 Type: single initiation site Name: Lpgat1_2 Description: Mus musculus lysophosphatidylglycerol acyltransferase 1 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M1510 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 191,718,811 - 191,718,871 EPDNEW
RGD ID: 6818041 Promoter ID: MM_KWN:3313 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000110855, ENSMUST00000110856, OTTMUST00000051904, OTTMUST00000051905, OTTMUST00000051906, UC007ECT.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 193,540,781 - 193,542,167 (+) MPROMDB
RGD ID: 6846620 Promoter ID: MM_ACW:3704 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung Transcripts: LPGAT1.FSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 193,542,709 - 193,543,209 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-04
Lpgat1
lysophosphatidylglycerol acyltransferase 1
AW112037
expressed sequence AW112037
Data merged from RGD:1607866
737654 PROVISIONAL
