Symbol:
COIL
Name:
coilin
RGD ID:
14097287
Description:
ENCODES a protein that exhibits disulfide oxidoreductase activity (ortholog); ASSOCIATED WITH hereditary breast ovarian cancer syndrome (ortholog); Joubert syndrome 1 (ortholog); FOUND IN female germ cell nucleus (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
COIL (coilin) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Coil (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Coil (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Coil (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
COIL (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
COIL (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Coil (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
COIL (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Coil (coilin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
Sscrofa11.1 - Pig Sscrofa11.1 Assembly
Position:
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 33,234,437 - 33,254,342 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 33,231,842 - 33,254,357 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 34,038,175 - 34,061,197 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
JBrowse:
View Region in Genome Browser (JBrowse)
Model
COIL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 33,234,437 - 33,254,342 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 33,231,842 - 33,254,357 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 34,038,175 - 34,061,197 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
COIL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 56,938,199 - 56,961,050 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 56,938,199 - 56,961,050 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 55,015,560 - 55,038,411 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 52,370,559 - 52,393,410 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 52,370,561 - 52,393,410 NCBI Celera 17 51,477,125 - 51,499,976 (-) NCBI Celera Cytogenetic Map 17 q22 NCBI HuRef 17 50,376,180 - 50,399,432 (-) NCBI HuRef CHM1_1 17 55,080,769 - 55,103,619 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 57,815,838 - 57,838,690 (-) NCBI T2T-CHM13v2.0
Coil Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 88,864,761 - 88,882,439 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 88,861,078 - 88,882,439 (+) Ensembl GRCm39 Ensembl GRCm38 11 88,973,935 - 88,991,613 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 88,970,252 - 88,991,613 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 88,835,249 - 88,852,927 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 88,790,040 - 88,807,703 (+) NCBI MGSCv36 mm8 Celera 11 98,590,249 - 98,608,066 (+) NCBI Celera Cytogenetic Map 11 C NCBI cM Map 11 54.34 NCBI
Coil Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 74,286,279 - 74,307,597 (+) NCBI GRCr8 mRatBN7.2 10 73,789,077 - 73,810,378 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 73,789,488 - 73,810,393 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 78,412,522 - 78,427,977 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 77,917,447 - 77,932,904 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 73,380,611 - 73,396,068 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 76,320,676 - 76,336,169 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 76,320,041 - 76,341,418 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 73,772,233 - 73,792,449 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 77,435,834 - 77,452,170 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 77,450,203 - 77,466,538 (+) NCBI Celera 10 72,695,262 - 72,710,398 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
Coil Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955451 5,884,233 - 5,898,525 (+) NCBI ChiLan1.0 ChiLan1.0
COIL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 73,111,130 - 73,134,002 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 77,922,063 - 77,944,941 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 51,015,403 - 51,038,276 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 55,876,226 - 55,898,862 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 55,877,098 - 55,898,827 (-) Ensembl panpan1.1 panPan2
COIL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 31,745,456 - 31,762,289 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 31,746,137 - 31,762,270 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 30,985,202 - 31,001,963 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 32,553,135 - 32,569,904 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 32,553,135 - 32,569,893 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 31,338,241 - 31,341,654 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 31,622,461 - 31,639,220 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 31,705,861 - 31,722,626 (-) NCBI UU_Cfam_GSD_1.0
Coil Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 31,106,367 - 31,124,937 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 5,950,034 - 5,962,095 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 5,950,215 - 5,968,772 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
COIL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 36,450,064 - 36,473,294 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 36,450,102 - 36,469,493 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 7,269,233 - 7,292,676 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Coil
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
10
4
23
3
2
5
14
12
23
3
6
3
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSSSCT00000019175 ⟹ ENSSSCP00000018668
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 12 33,234,437 - 33,254,342 (-) Ensembl
Ensembl Acc Id:
ENSSSCT00000041196 ⟹ ENSSSCP00000056218
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 12 33,234,437 - 33,254,342 (-) Ensembl
Ensembl Acc Id:
ENSSSCT00000052693 ⟹ ENSSSCP00000040475
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 12 33,146,921 - 33,254,319 (-) Ensembl
RefSeq Acc Id:
XM_003131625 ⟹ XP_003131673
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 12 33,231,842 - 33,254,357 (-) NCBI
Sequence:
GGTAGCCCAGTGGTGTCTCTCGGCTTCCGTTGCGCATCGAGCAAGATGGCAGCCTCCGAGACGGTTAGGCTACGGCTTCAATTTGATTACCCGCCGCCGGCCACCCCGCATTGCACGTCCTTCTGGCT
hide sequence
RefSeq Acc Id:
XP_003131673 ⟸ XM_003131625
- UniProtKB:
A0A8D0R5U0 (UniProtKB/TrEMBL)
- Sequence:
MAASETVRLRLQFDYPPPATPHCTSFWLLIDLNRCRFVTDLISLIRQRFGFSSGALLGLYLDGGLLPPAESARLVRDNDSLRVKLEERGVADSPVAVSNGDSTPLVPRKAKKRAFKSEEDEETELDCR
hide sequence
Ensembl Acc Id:
ENSSSCP00000018668 ⟸ ENSSSCT00000019175
Ensembl Acc Id:
ENSSSCP00000056218 ⟸ ENSSSCT00000041196
Ensembl Acc Id:
ENSSSCP00000040475 ⟸ ENSSSCT00000052693
