Advanced Search (OLGA)

Gene: OR2A7 (olfactory receptor family 2 subfamily A member 7) Homo sapiens

Analyze

Symbol:

OR2A7

Name:

olfactory receptor family 2 subfamily A member 7

RGD ID:

1348744

HGNC Page

HGNC:8234

Description:

Predicted to enable odorant binding activity and olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Predicted to be active in membrane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

HSDJ0798C17; olfactory receptor 2A7; olfactory receptor OR7-18; olfactory receptor OR7-20; olfactory receptor, family 2, subfamily A, member 21; olfactory receptor, family 2, subfamily A, member 7; OR2A21

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	144,257,663 - 144,264,792 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	144,257,663 - 144,264,792 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	143,954,756 - 143,961,885 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	143,586,722 - 143,587,654 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	143,393,436 - 143,394,369	NCBI
Celera	6	132,768,253 - 132,769,185 (-)	NCBI		Celera
Cytogenetic Map	7	q35	NCBI
HuRef	7	138,089,781 - 138,090,713 (+)	NCBI		HuRef
CHM1_1	7	143,893,176 - 143,894,108 (-)	NCBI		CHM1_1
CRA_TCAGchr7v2	7	143,294,047 - 143,294,979 (-)	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',5,5'-tetrachlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

acrylamide (ISO)

aflatoxin B1 (EXP)

ammonium chloride (ISO)

benzo[a]pyrene (EXP)

bis(2-ethylhexyl) phthalate (EXP)

cadmium atom (EXP)

cadmium dichloride (EXP)

silicon dioxide (EXP)

sodium arsenite (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IBA,IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IBA,IEA)

plasma membrane (IEA,TAS)

Molecular Function

G protein-coupled receptor activity (IEA)

odorant binding (IBA)

olfactory receptor activity (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12213199	PMID:12477932	PMID:14983052	PMID:21873635	PMID:27315375

Genomics

Comparative Map Data

OR2A7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	144,257,663 - 144,264,792 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	144,257,663 - 144,264,792 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	143,954,756 - 143,961,885 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	143,586,722 - 143,587,654 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	143,393,436 - 143,394,369	NCBI
Celera	6	132,768,253 - 132,769,185 (-)	NCBI		Celera
Cytogenetic Map	7	q35	NCBI
HuRef	7	138,089,781 - 138,090,713 (+)	NCBI		HuRef
CHM1_1	7	143,893,176 - 143,894,108 (-)	NCBI		CHM1_1
CRA_TCAGchr7v2	7	143,294,047 - 143,294,979 (-)	NCBI

Or2a7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	43,150,922 - 43,151,854 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	43,149,074 - 43,154,394 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	43,173,988 - 43,174,920 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	43,172,140 - 43,177,460 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	43,123,987 - 43,124,919 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	43,103,595 - 43,104,527 (+)	NCBI		MGSCv36	mm8
Celera	6	43,121,688 - 43,122,620 (+)	NCBI		Celera
Cytogenetic Map	6	B2.1	NCBI
cM Map	6	21.1	NCBI

Or2a7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	72,979,036 - 72,979,968 (+)	NCBI		GRCr8
mRatBN7.2	4	71,979,026 - 71,979,958 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	71,976,693 - 71,980,863 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	76,970,375 - 76,971,307 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	72,883,605 - 72,884,537 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	71,272,943 - 71,273,875 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	72,603,242 - 72,604,174 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	72,603,242 - 72,604,174 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	137,305,509 - 137,306,191 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	70,919,543 - 70,920,475 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	71,195,672 - 71,196,605 (+)	NCBI
Celera	4	66,924,820 - 66,925,752 (+)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

OR2A7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	5,725,634 - 5,730,268 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	5,725,751 - 5,726,683 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	6,837,769 - 6,838,701 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	5,590,151 - 5,594,791 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	5,590,268 - 5,591,200 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	5,519,547 - 5,520,479 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	5,377,978 - 5,378,910 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	5,449,155 - 5,450,087 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100511466
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	9	113,457,987 - 113,458,928 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	124,906,828 - 124,907,760 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103227416
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	112,930,270 - 112,939,631 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666072	9,708,052 - 9,709,773 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in OR2A7
21 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh37/hg19 7q22.1-36.3(chr7:98693388-159119707)x3	copy number gain	not provided [RCV000682911]	Chr7:98693388..159119707 [GRCh37] Chr7:7q22.1-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:137456457-159119707)x3	copy number gain	not specified [RCV003986713]	Chr7:137456457..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q33-36.3(chr7:136309982-159307523)x3	copy number gain	See cases [RCV000053576]	Chr7:136309982..159307523 [GRCh38] Chr7:135994730..159100212 [GRCh37] Chr7:135645270..158792973 [NCBI36] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:142021716-159325876)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053577]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053577]\|See cases [RCV000053577]	Chr7:142021716..159325876 [GRCh38] Chr7:142528609..159118566 [GRCh37] Chr7:141367985..158811327 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7p22.3-q36.3(chr7:53985-159282531)x1	copy number loss	See cases [RCV000052250]	Chr7:53985..159282531 [GRCh38] Chr7:53985..159075220 [GRCh37] Chr7:149068..158767981 [NCBI36] Chr7:7p22.3-q36.3	pathogenic
GRCh38/hg38 7q32.3-36.1(chr7:132023155-149309794)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054172]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054172]\|See cases [RCV000054172]	Chr7:132023155..149309794 [GRCh38] Chr7:131707914..149006885 [GRCh37] Chr7:131358454..148637818 [NCBI36] Chr7:7q32.3-36.1	pathogenic
GRCh38/hg38 7q34-36.3(chr7:139365967-159282531)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054175]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054175]\|See cases [RCV000054175]	Chr7:139365967..159282531 [GRCh38] Chr7:139050713..159075220 [GRCh37] Chr7:138701253..158767981 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:140754198-159307523)x1	copy number loss	See cases [RCV000054176]	Chr7:140754198..159307523 [GRCh38] Chr7:140453998..159100212 [GRCh37] Chr7:140100467..158792973 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:142358524-159282531)x1	copy number loss	See cases [RCV000054177]	Chr7:142358524..159282531 [GRCh38] Chr7:142528609..159075220 [GRCh37] Chr7:141726947..158767981 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q35-36.3(chr7:143884559-159282390)x1	copy number loss	See cases [RCV000054178]	Chr7:143884559..159282390 [GRCh38] Chr7:143581652..159075079 [GRCh37] Chr7:143212585..158767840 [NCBI36] Chr7:7q35-36.3	pathogenic
GRCh38/hg38 7q32.1-36.3(chr7:129310166-159282390)x3	copy number gain	See cases [RCV000050876]	Chr7:129310166..159282390 [GRCh38] Chr7:128950007..159075079 [GRCh37] Chr7:128737243..158767840 [NCBI36] Chr7:7q32.1-36.3	pathogenic
GRCh38/hg38 7q32.3-36.3(chr7:132850196-159325876)x3	copy number gain	See cases [RCV000051101]	Chr7:132850196..159325876 [GRCh38] Chr7:132534956..159118566 [GRCh37] Chr7:132185496..158811327 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q35-36.1(chr7:143884559-152674271)x1	copy number loss	See cases [RCV000050750]	Chr7:143884559..152674271 [GRCh38] Chr7:143581652..152371356 [GRCh37] Chr7:143212585..152002289 [NCBI36] Chr7:7q35-36.1	pathogenic
NM_001005328.1(OR2A7):c.602G>A (p.Gly201Glu)	single nucleotide variant	Malignant melanoma [RCV000067735]	Chr7:144259027 [GRCh38] Chr7:143956120 [GRCh37] Chr7:143587053 [NCBI36] Chr7:7q35	not provided
GRCh38/hg38 7q21.3-36.3(chr7:97419852-158923762)x3	copy number gain	See cases [RCV000136717]	Chr7:97419852..158923762 [GRCh38] Chr7:97049164..158716453 [GRCh37] Chr7:96887100..158409214 [NCBI36] Chr7:7q21.3-36.3	pathogenic
GRCh38/hg38 7q34-35(chr7:141126407-145652221)x3	copy number gain	See cases [RCV000133645]	Chr7:141126407..145652221 [GRCh38] Chr7:140826207..145349314 [GRCh37] Chr7:140472676..144980247 [NCBI36] Chr7:7q34-35	pathogenic
GRCh38/hg38 7q34-36.3(chr7:141960861-159335866)x1	copy number loss	See cases [RCV000137256]	Chr7:141960861..159335866 [GRCh38] Chr7:142528609..159128556 [GRCh37] Chr7:141307130..158821317 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q35(chr7:143735880-144409525)x3	copy number gain	See cases [RCV000136107]	Chr7:143735880..144409525 [GRCh38] Chr7:143432973..144106618 [GRCh37] Chr7:143063906..143737551 [NCBI36] Chr7:7q35	likely benign
GRCh38/hg38 7q35(chr7:144254868-144354157)x1	copy number loss	See cases [RCV000136194]	Chr7:144254868..144354157 [GRCh38] Chr7:143951961..144051250 [GRCh37] Chr7:143582894..143682183 [NCBI36] Chr7:7q35	benign
GRCh38/hg38 7p22.3-q36.3(chr7:54185-159282390)x1	copy number loss	See cases [RCV000135401]	Chr7:54185..159282390 [GRCh38] Chr7:54185..159075079 [GRCh37] Chr7:149268..158767840 [NCBI36] Chr7:7p22.3-q36.3	pathogenic
GRCh38/hg38 7q33-36.2(chr7:137751200-154815582)x3	copy number gain	See cases [RCV000136592]	Chr7:137751200..154815582 [GRCh38] Chr7:137435946..154607292 [GRCh37] Chr7:137086486..154238225 [NCBI36] Chr7:7q33-36.2	pathogenic
GRCh38/hg38 7q33-36.1(chr7:135017687-148807400)x1	copy number loss	See cases [RCV000138903]	Chr7:135017687..148807400 [GRCh38] Chr7:134702438..148504492 [GRCh37] Chr7:134352978..148135425 [NCBI36] Chr7:7q33-36.1	pathogenic
GRCh38/hg38 7q31.2-36.3(chr7:115459015-159325817)x3	copy number gain	See cases [RCV000141413]	Chr7:115459015..159325817 [GRCh38] Chr7:115099069..159118507 [GRCh37] Chr7:114886305..158811268 [NCBI36] Chr7:7q31.2-36.3	pathogenic
GRCh38/hg38 7q33-36.3(chr7:134666829-158591882)x1	copy number loss	See cases [RCV000138120]	Chr7:134666829..158591882 [GRCh38] Chr7:134351581..158384574 [GRCh37] Chr7:134002121..158077335 [NCBI36] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q35(chr7:144227698-144354186)x3	copy number gain	See cases [RCV000138461]	Chr7:144227698..144354186 [GRCh38] Chr7:143924791..144051279 [GRCh37] Chr7:143555724..143682212 [NCBI36] Chr7:7q35	likely benign
GRCh38/hg38 7q32.3-36.3(chr7:132444095-159335866)x3	copy number gain	See cases [RCV000139654]	Chr7:132444095..159335866 [GRCh38] Chr7:132128854..159128556 [GRCh37] Chr7:131779394..158821317 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q35-36.1(chr7:143596735-150089125)x4	copy number gain	See cases [RCV000138555]	Chr7:143596735..150089125 [GRCh38] Chr7:143293828..149786214 [GRCh37] Chr7:143003950..149417147 [NCBI36] Chr7:7q35-36.1	likely pathogenic
GRCh38/hg38 7q31.32-36.3(chr7:121863759-159335865)x3	copy number gain	See cases [RCV000138847]	Chr7:121863759..159335865 [GRCh38] Chr7:121503813..159128555 [GRCh37] Chr7:121291049..158821316 [NCBI36] Chr7:7q31.32-36.3	pathogenic
GRCh38/hg38 7q35(chr7:144186919-144354186)x3	copy number gain	See cases [RCV000138865]	Chr7:144186919..144354186 [GRCh38] Chr7:143884012..144051279 [GRCh37] Chr7:143514945..143682212 [NCBI36] Chr7:7q35	likely benign
GRCh38/hg38 7q35(chr7:144186919-144354186)x1	copy number loss	See cases [RCV000138866]	Chr7:144186919..144354186 [GRCh38] Chr7:143884012..144051279 [GRCh37] Chr7:143514945..143682212 [NCBI36] Chr7:7q35	likely benign
GRCh38/hg38 7q32.3-36.3(chr7:132438072-159327017)x3	copy number gain	See cases [RCV000143707]	Chr7:132438072..159327017 [GRCh38] Chr7:132122831..159119707 [GRCh37] Chr7:131773371..158812468 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q34-35(chr7:140061285-144622893)x3	copy number gain	See cases [RCV000143724]	Chr7:140061285..144622893 [GRCh38] Chr7:139761085..144319986 [GRCh37] Chr7:139407554..143950919 [NCBI36] Chr7:7q34-35	uncertain significance
GRCh38/hg38 7q32.3-36.3(chr7:131171478-159327017)x3	copy number gain	See cases [RCV000143754]	Chr7:131171478..159327017 [GRCh38] Chr7:130856237..159119707 [GRCh37] Chr7:130506777..158812468 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q32.3-36.3(chr7:131228764-159335866)x3	copy number gain	See cases [RCV000142802]	Chr7:131228764..159335866 [GRCh38] Chr7:130913523..159128556 [GRCh37] Chr7:130564063..158821317 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh37/hg19 7q35-36.3(chr7:143839360-159138663)	copy number loss	Abnormal esophagus morphology [RCV000416719]	Chr7:143839360..159138663 [GRCh37] Chr7:7q35-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:43360-159119707)x1	copy number loss	See cases [RCV000446044]	Chr7:43360..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q22.1-36.3(chr7:98969247-159119707)x3	copy number gain	See cases [RCV000447709]	Chr7:98969247..159119707 [GRCh37] Chr7:7q22.1-36.3	pathogenic
GRCh37/hg19 7q32.1-36.3(chr7:128276078-159119707)x3	copy number gain	See cases [RCV000447956]	Chr7:128276078..159119707 [GRCh37] Chr7:7q32.1-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:137589621-159119707)x3	copy number gain	See cases [RCV000449264]	Chr7:137589621..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:133799185-159119707)x1	copy number loss	See cases [RCV000448836]	Chr7:133799185..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:136758593-159119707)x3	copy number gain	See cases [RCV000510490]	Chr7:136758593..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:43361-159119707)	copy number gain	See cases [RCV000510686]	Chr7:43361..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:140636858-159119707)x1	copy number loss	See cases [RCV000510250]	Chr7:140636858..159119707 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:137917376-159119707)x1	copy number loss	See cases [RCV000511889]	Chr7:137917376..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:43361-159119707)x3	copy number gain	See cases [RCV000511549]	Chr7:43361..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:140133025-158982771)x1	copy number loss	not provided [RCV000682910]	Chr7:140133025..158982771 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:139623170-158329903)x3	copy number gain	not provided [RCV000747070]	Chr7:139623170..158329903 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:141938235-159126310)x1	copy number loss	not provided [RCV000747083]	Chr7:141938235..159126310 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q35-36.1(chr7:143711059-152573935)x3	copy number gain	not provided [RCV000747094]	Chr7:143711059..152573935 [GRCh37] Chr7:7q35-36.1	benign
GRCh37/hg19 7q35(chr7:143887276-144079906)x1	copy number loss	not provided [RCV000747095]	Chr7:143887276..144079906 [GRCh37] Chr7:7q35	uncertain significance
GRCh37/hg19 7p22.3-q36.3(chr7:10704-159122532)x3	copy number gain	not provided [RCV000746278]	Chr7:10704..159122532 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:44935-159126310)x3	copy number gain	not provided [RCV000746280]	Chr7:44935..159126310 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q32.1-36.3(chr7:128312450-159119220)	copy number gain	not provided [RCV000767558]	Chr7:128312450..159119220 [GRCh37] Chr7:7q32.1-36.3	pathogenic
GRCh37/hg19 7q34-35(chr7:141751875-147105208)x3	copy number gain	not provided [RCV000848670]	Chr7:141751875..147105208 [GRCh37] Chr7:7q34-35	uncertain significance
GRCh37/hg19 7p22.3-q36.3(chr7:10365-159119707)x3	copy number gain	not provided [RCV000848126]	Chr7:10365..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q35(chr7:143572320-144474990)x3	copy number gain	not provided [RCV000848430]	Chr7:143572320..144474990 [GRCh37] Chr7:7q35	uncertain significance
GRCh37/hg19 7q32.3-36.3(chr7:130592554-159119707)x3	copy number gain	not provided [RCV000849569]	Chr7:130592554..159119707 [GRCh37] Chr7:7q32.3-36.3	pathogenic
GRCh37/hg19 7q31.1-36.3(chr7:109251060-159119707)x3	copy number gain	not provided [RCV001005994]	Chr7:109251060..159119707 [GRCh37] Chr7:7q31.1-36.3	pathogenic
GRCh37/hg19 7q32.3-36.3(chr7:131414604-159126310)x1	copy number loss	See cases [RCV001007432]	Chr7:131414604..159126310 [GRCh37] Chr7:7q32.3-36.3	pathogenic
GRCh37/hg19 7q35-36.3(chr7:143107740-156886246)x3	copy number gain	not provided [RCV001249383]	Chr7:143107740..156886246 [GRCh37] Chr7:7q35-36.3	not provided
GRCh37/hg19 7q33-36.3(chr7:133851002-159119707)x3	copy number gain	not provided [RCV001834520]	Chr7:133851002..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7q33-35(chr7:133848099-145814115)x1	copy number loss	Hypertelorism [RCV001801200]	Chr7:133848099..145814115 [GRCh37] Chr7:7q33-35	pathogenic
Single allele	complex	Ring chromosome 7 [RCV002280646]	Chr7:43360..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q35(chr7:143425718-144075390)x1	copy number loss	See cases [RCV002286335]	Chr7:143425718..144075390 [GRCh37] Chr7:7q35	uncertain significance
GRCh37/hg19 7p22.3-q36.3(chr7:56604613-96692931)x1	copy number loss	See cases [RCV002287832]	Chr7:56604613..96692931 [GRCh37] Chr7:7p22.3-q36.3	uncertain significance
GRCh37/hg19 7q32.3-36.1(chr7:131779213-149042734)x1	copy number loss	not provided [RCV002472560]	Chr7:131779213..149042734 [GRCh37] Chr7:7q32.3-36.1	pathogenic
NM_001005328.2(OR2A7):c.664T>A (p.Cys222Ser)	single nucleotide variant	not specified [RCV004244416]	Chr7:144258965 [GRCh38] Chr7:143956058 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.383C>A (p.Pro128His)	single nucleotide variant	not specified [RCV004231676]	Chr7:144259246 [GRCh38] Chr7:143956339 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.14T>C (p.Ile5Thr)	single nucleotide variant	not specified [RCV004175977]	Chr7:144259615 [GRCh38] Chr7:143956708 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.257A>T (p.His86Leu)	single nucleotide variant	not specified [RCV004258978]	Chr7:144259372 [GRCh38] Chr7:143956465 [GRCh37] Chr7:7q35	uncertain significance
NC_000007.13:g.(?_130781014)_(150301047_?)del	deletion	not provided [RCV003116360]	Chr7:130781014..150301047 [GRCh37] Chr7:7q32.3-36.1	pathogenic
NM_001005328.2(OR2A7):c.743G>T (p.Gly248Val)	single nucleotide variant	not specified [RCV004277033]	Chr7:144258886 [GRCh38] Chr7:143955979 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.809A>G (p.Lys270Arg)	single nucleotide variant	not specified [RCV004302267]	Chr7:144258820 [GRCh38] Chr7:143955913 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.454G>A (p.Val152Ile)	single nucleotide variant	not specified [RCV004313794]	Chr7:144259175 [GRCh38] Chr7:143956268 [GRCh37] Chr7:7q35	uncertain significance
GRCh38/hg38 7q33-36.3(chr7:137463392-159345973)x3	copy number gain	Neurodevelopmental disorder [RCV003327609]	Chr7:137463392..159345973 [GRCh38] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:138620939-159233475)x3	copy number gain	Neurodevelopmental disorder [RCV003327610]	Chr7:138620939..159233475 [GRCh38] Chr7:7q34-36.3	likely pathogenic
NM_001005328.2(OR2A7):c.236G>A (p.Arg79Gln)	single nucleotide variant	not specified [RCV004342912]	Chr7:144259393 [GRCh38] Chr7:143956486 [GRCh37] Chr7:7q35	likely benign
GRCh37/hg19 7q34-36.1(chr7:140154317-152551638)x1	copy number loss	not provided [RCV003334300]	Chr7:140154317..152551638 [GRCh37] Chr7:7q34-36.1	pathogenic
NM_001005328.2(OR2A7):c.805C>A (p.Gln269Lys)	single nucleotide variant	not specified [RCV004352817]	Chr7:144258824 [GRCh38] Chr7:143955917 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.806A>G (p.Gln269Arg)	single nucleotide variant	not specified [RCV004352818]	Chr7:144258823 [GRCh38] Chr7:143955916 [GRCh37] Chr7:7q35	uncertain significance
GRCh37/hg19 7q33-36.3(chr7:135639005-159119707)x1	copy number loss	not provided [RCV003482988]	Chr7:135639005..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:142099013-159119707)x1	copy number loss	not provided [RCV003482989]	Chr7:142099013..159119707 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:141690279-159119707)x3	copy number gain	See cases [RCV004442845]	Chr7:141690279..159119707 [GRCh37] Chr7:7q34-36.3	pathogenic
NM_001005328.2(OR2A7):c.155C>G (p.Ser52Cys)	single nucleotide variant	not specified [RCV004501889]	Chr7:144259474 [GRCh38] Chr7:143956567 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.215A>G (p.Tyr72Cys)	single nucleotide variant	not specified [RCV004501890]	Chr7:144259414 [GRCh38] Chr7:143956507 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.140T>A (p.Leu47His)	single nucleotide variant	not specified [RCV004501888]	Chr7:144259489 [GRCh38] Chr7:143956582 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.238A>C (p.Met80Leu)	single nucleotide variant	not specified [RCV004501891]	Chr7:144259391 [GRCh38] Chr7:143956484 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.293T>C (p.Met98Thr)	single nucleotide variant	not specified [RCV004501892]	Chr7:144259336 [GRCh38] Chr7:143956429 [GRCh37] Chr7:7q35	likely benign
NM_001005328.2(OR2A7):c.548T>C (p.Val183Ala)	single nucleotide variant	not specified [RCV004501893]	Chr7:144259081 [GRCh38] Chr7:143956174 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.582T>G (p.Asn194Lys)	single nucleotide variant	not specified [RCV004501894]	Chr7:144259047 [GRCh38] Chr7:143956140 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.859C>T (p.Leu287Phe)	single nucleotide variant	not specified [RCV004655371]	Chr7:144258770 [GRCh38] Chr7:143955863 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.235C>T (p.Arg79Trp)	single nucleotide variant	not specified [RCV004646294]	Chr7:144259394 [GRCh38] Chr7:143956487 [GRCh37] Chr7:7q35	uncertain significance
NM_001005328.2(OR2A7):c.751T>C (p.Tyr251His)	single nucleotide variant	not specified [RCV004655370]	Chr7:144258878 [GRCh38] Chr7:143955971 [GRCh37] Chr7:7q35	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	132
Count of miRNA genes:	132
Interacting mature miRNAs:	132
Transcripts:	ENST00000493325
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1559221	SCL67_H	Serum cholesterol level QTL 67 (human)	2.98	0.002	Lipid level	triglyceride	7	141776251	159345973	Human
1559237	SCL70_H	Serum cholesterol level QTL 70 (human)	3.52	0.002	Lipid level	triglyceride	7	141776251	159345973	Human
1578618	SCL127_H	Serum cholesterol level QTL 127 (human)	3.7		Lipid level	triglyceride	7	141776251	159345973	Human
1559218	SCL69_H	Serum cholesterol level QTL 69 (human)	3.41	0.002	Lipid level	triglyceride	7	141776251	159345973	Human
1559232	SCL66_H	Serum cholesterol level QTL 66 (human)	2.98	0.002	Lipid level	triglyceride	7	141776251	159345973	Human
1559264	SCL68_H	Serum cholesterol level QTL 68 (human)	3.1	0.002	Lipid level	triglyceride	7	141776251	159345973	Human
1559263	SCL72_H	Serum cholesterol level QTL 72 (human)	3.25		Lipid level	triglyceride	7	141776251	159345973	Human
1559213	SCL71_H	Serum cholesterol level QTL 71 (human)	3.46		Lipid level	triglyceride	7	141776251	159345973	Human
1578610	SCL128_H	Serum cholesterol level QTL 128 (human)	2.2		Lipid level	LDL cholesterol	7	141776251	159345973	Human

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1200	2416	2509	2140	4177	1689	2265	4	600	1190	442	2233	6148	5592	36	2972	838	1708	1555	170

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001005328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC004889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC245175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF327904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF399598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC136704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC136711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK004218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK004610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KP290567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000493325 ⟹ ENSP00000420502

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	7	144,258,607 - 144,259,722 (-)	Ensembl

Ensembl Acc Id:

ENST00000641841 ⟹ ENSP00000493320

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	7	144,257,663 - 144,264,792 (-)	Ensembl

RefSeq Acc Id:

NM_001005328 ⟹ NP_001005328

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	7	144,257,663 - 144,264,792 (-)	NCBI
GRCh37	7	143,955,789 - 143,956,721 (-)	RGD
Build 36	7	143,586,722 - 143,587,654 (-)	NCBI Archive
HuRef	7	138,089,781 - 138,090,713 (+)	RGD
CHM1_1	7	143,893,176 - 143,894,108 (-)	NCBI
CRA_TCAGchr7v2	7	143,294,047 - 143,294,979 (-)	ENTREZGENE

Sequence:

show sequence

ATCACGTGTTGTTTAATGATGCGGATACGTTCTGAGAAATGTGCGGTCAAGTGATTCTGACATT
GTGTGAACATCCAGAAAGGACTTCACGGGGATATGGGGGACAATATAACATCCATCACAGAGTT
CCTCCTACTGGGATTTCCCGTTGGCCCAAGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTG
TTCTACGTCTTCACCCTGCTGGGGAACGGGACCATACTGGGGCTCATCTCACTGGACTCCAGAC
TGCACGCCCCCATGTACTTCTTCCTCTCACACCTGGCGGTCGTCGACATCGCCTACGCCTGCAA
CACGGTGCCCCGGATGCTGGTGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCGGGCCGC
ATGATGCAGACCTTTCTGTTTTCCACTTTTGCTGTCACAGAATGTCTCCTCCTGGTGGTGATGT
CCTATGATCTGTACGTGGCCATCTGCCACCCCCTCCGATATTTGGCCATCATGACCTGGAGAGT
CTGCATCACCCTCGCGGTGACTTCCTGGACCACTGGAGTCCTTTTATCCTTGATTCATCTTGTG
TTACTTCTACCTTTACCCTTCTGTAGGCCCCAGAAAATTTATCACTTTTTTTGTGAAATCTTGG
CTGTTCTCAAACTTGCCTGTGCAGATACCCACATCAATGAGAACATGGTCTTGGCCGGAGCAAT
TTCTGGGCTGGTGGGACCCTTGTCCACAATTGTAGTTTCATATATGTGCATCCTCTGTGCTATC
CTTCAGATCCAATCAAGGGAAGTTCAGAGGAAAGCCTTCTGCACCTGCTTCTCCCACCTCTGTG
TGATTGGACTCTTTTATGGCACAGCCATTATCATGTATGTTGGACCCAGATATGGGAACCCCAA
GGAGCAGAAGAAATATCTCCTGCTGTTTCACAGCCTCTTTAATCCCATGCTCAATCCCCTTATC
TGTAGTCTTAGGAACTCAGAAGTGAAGAATACTTTGAAGAGAGTGCTGGGAGTAGAAAGGGCTT
TATGAAAAGGATTATGGCATTGTGACTGACAGTGACCTAGGAAGTTACATCATTGAGCGGTTCT
TAACCCATCTCTGCACTGGTGGGACCTCTGCCCTCAATGGACATGAGAATTATCTGAGACATTT
ATTTAAAATGGAGCTATCTCCTGCCCTACCTTTAAATGACTGATTTCAGCAGATGTGGGATGAA
ATTCTAGAAATTGATCTCTTCAAGTTGTGCTGCAGCCACTCCACACCAGGACAATACCCCTTAC
AATATCCTCATTAGCTTTTGATCCAGTCCCATACCTCCCATAATGTTTTCCTCAAAACACTGGT
CCCTTCAGAGGACTTTAAAAATAAGTTCTATAGTCAAATAAGTTTGAGACTTACTTCACATCAG
ATGCCTCTGTCTAGGGATCACAATTCATATTAGCATAGTGAATGCTGTAAATATTTCTCTAGGA
AAGAATAATTCTATACCAGCTTTAAGCCAGTGTTTTCTAAACTTATGTGAGCACATAAAATTTC
CTTTGTAATACTTAGTAACAGTTTCCTGGAACAGGAGATCTTGATATTAATTGACTCATTGTGA
ATACTTCCTACAGCCCCCTTCTAGGGCAGAATGATTTCTTTTTTCCTTGCAAAGTGAGCCTCTA
AAGAGATGTAGTTCTGAGCATTATGCCTCGATCAGTCTGTAAAAATCCGGGTTCTGTTTGGATA
CAGACCGTGAGGGACCCTGTCTCTACTGTTCAATGGTAGATCATCTAAAGAAAATAAATGCAAT
CCTGTCCTTCATCATGGATCGGCATTCCTGCTATAGAAGCTTCAGGAGATGACCTCATTCAACC
TCACAATCTTCTAAATTTGAGATTTTTAAGAAATATGATTCAGTATACATCTGCCTGTGTTTGC
CGCTGAATGAAATCAATCTAATTTTTCTAATTCAGGGTTTTCAAGATAAACCCAGATTTCTCAA
GAAAGAAAAATCTAGAAAGATTTCAAAATCCACCACCTACACACTTAAAAGTTGTAGCAGCTTC
TTATGCCATGGGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001005328	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG50283	(Get FASTA)	NCBI Sequence Viewer
	AAI36705	(Get FASTA)	NCBI Sequence Viewer
	AAI36712	(Get FASTA)	NCBI Sequence Viewer
	AAK95083	(Get FASTA)	NCBI Sequence Viewer
	ALI87725	(Get FASTA)	NCBI Sequence Viewer
	DAA04616	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000420502.1
	ENSP00000493320
	ENSP00000493320.1
	ENSP00000493470.1
	ENSP00000493694.1
GenBank Protein	Q96R45	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001005328 ⟸ NM_001005328

- UniProtKB:

Q96R45 (UniProtKB/Swiss-Prot), Q6IFP4 (UniProtKB/Swiss-Prot), B2RN57 (UniProtKB/Swiss-Prot), A0A126GVA9 (UniProtKB/TrEMBL), A0A126GWD8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYFFLSH
LAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYDLYVAICHP
LRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEILAVLKLACADTH
INENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTCFSHLCVIGLFYGTAII
MYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTLKRVLGVERAL

hide sequence

Ensembl Acc Id:

ENSP00000420502 ⟸ ENST00000493325

Ensembl Acc Id:

ENSP00000493320 ⟸ ENST00000641841

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q96R45-F1-model_v2	AlphaFold	Q96R45	1-310	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:8234	AgrOrtholog
COSMIC	OR2A7	COSMIC
Ensembl Genes	ENSG00000243896	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000284749	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000493325.1	UniProtKB/Swiss-Prot
	ENST00000641841	ENTREZGENE
	ENST00000641841.1	UniProtKB/Swiss-Prot
	ENST00000643586.2	UniProtKB/Swiss-Prot
	ENST00000643902.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000243896	GTEx
	ENSG00000284749	GTEx
HGNC ID	HGNC:8234	ENTREZGENE
Human Proteome Map	OR2A7	Human Proteome Map
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:401427	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	OR2A7	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORY RECEPTOR 13	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA32120	PharmGKB
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A126GVA9	ENTREZGENE, UniProtKB/TrEMBL
	A0A126GWD8	ENTREZGENE, UniProtKB/TrEMBL
	B2RN57	ENTREZGENE
	OR2A7_HUMAN	UniProtKB/Swiss-Prot
	Q6IFP4	ENTREZGENE
	Q96R45	ENTREZGENE
UniProt Secondary	B2RN57	UniProtKB/Swiss-Prot
	Q6IFP4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-15	OR2A7	olfactory receptor family 2 subfamily A member 7	OR2A7	olfactory receptor, family 2, subfamily A, member 7	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message