Symbol:
Mmrn2
Name:
multimerin 2
RGD ID:
1322934
MGI Page
MGI
Description:
Predicted to enable receptor ligand activity. Predicted to be an extracellular matrix structural constituent. Involved in cell migration involved in sprouting angiogenesis; negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis; and positive regulation of defense response to bacterium. Located in basement membrane. Is expressed in several structures, including cardiovascular system; early conceptus; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human MMRN2 (multimerin 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AA986839; elastin microfibril interfacer 3; Emi; Emilin3; ENDOGL; EndoGly; EndoGlyx-1; ENDOGLYX1; MGC41271; multimerin-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MMRN2 (multimerin 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mmrn2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mmrn2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MMRN2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MMRN2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mmrn2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MMRN2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MMRN2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mmrn2 (multimerin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mmrn2 (multimerin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MMRN2 (multimerin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mmrn2b (multimerin 2b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
mmrn2a (multimerin 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mmrn2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 34,097,461 - 34,126,244 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 34,097,422 - 34,126,244 (+) Ensembl GRCm39 Ensembl GRCm38 14 34,375,504 - 34,404,287 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 34,375,465 - 34,404,287 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 35,188,690 - 35,217,473 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 33,204,621 - 33,232,834 (+) NCBI MGSCv36 mm8 Celera 14 30,641,747 - 30,669,702 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 20.81 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mmrn2 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of MMRN2 mRNA CTD PMID:28960355 Mmrn2 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of MMRN2 mRNA CTD PMID:22206623 Mmrn2 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MMRN2 mRNA CTD PMID:17942748 Mmrn2 Mouse 17beta-estradiol multiple interactions ISO MMRN2 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of MMRN2 mRNA CTD PMID:30165855 Mmrn2 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MMRN2 mRNA CTD PMID:39298647 Mmrn2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MMRN2 mRNA CTD PMID:17942748 Mmrn2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mmrn2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MMRN2 mRNA CTD PMID:34747641 Mmrn2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MMRN2 mRNA CTD PMID:19465110 Mmrn2 Mouse 2,6-dinitrotoluene affects expression ISO Mmrn2 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of MMRN2 mRNA CTD PMID:21346803 Mmrn2 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of MMRN2 mRNA CTD PMID:30951980 Mmrn2 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of MMRN2 gene CTD PMID:31683443 Mmrn2 Mouse 4,4'-sulfonyldiphenol affects expression EXP 6480464 bisphenol S affects the expression of MMRN2 mRNA CTD PMID:39298647 Mmrn2 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of MMRN2 mRNA CTD PMID:28973697 Mmrn2 Mouse aflatoxin B1 increases methylation ISO MMRN2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MMRN2 gene CTD PMID:27153756 Mmrn2 Mouse alpha-Zearalanol multiple interactions ISO Mmrn2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MMRN2 mRNA CTD PMID:35163327 Mmrn2 Mouse aristolochic acid A increases expression ISO MMRN2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MMRN2 mRNA CTD PMID:33212167 Mmrn2 Mouse arsane increases methylation ISO MMRN2 (Homo sapiens) 6480464 Arsenic results in increased methylation of MMRN2 promoter CTD PMID:21291286 Mmrn2 Mouse arsenic atom increases methylation ISO MMRN2 (Homo sapiens) 6480464 Arsenic results in increased methylation of MMRN2 promoter CTD PMID:21291286 Mmrn2 Mouse atrazine decreases expression ISO Mmrn2 (Rattus norvegicus) 6480464 Atrazine results in decreased expression of MMRN2 mRNA CTD PMID:36841081 Mmrn2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MMRN2 mRNA CTD PMID:21964900 and PMID:22610609 Mmrn2 Mouse benzo[a]pyrene affects methylation ISO MMRN2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MMRN2 promoter CTD PMID:27901495 Mmrn2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MMRN2 mRNA CTD PMID:27858113 Mmrn2 Mouse benzo[b]fluoranthene increases expression EXP 6480464 benzo(b)fluoranthene results in increased expression of MMRN2 mRNA CTD PMID:26377693 Mmrn2 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MMRN2 mRNA CTD PMID:27858113 Mmrn2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MMRN2 mRNA CTD PMID:30951980 Mmrn2 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of MMRN2 mRNA CTD PMID:30951980 Mmrn2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of MMRN2 mRNA CTD PMID:25554681 Mmrn2 Mouse chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of MMRN2 mRNA CTD PMID:23125180 Mmrn2 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MMRN2 mRNA CTD PMID:34289071 and PMID:37019170 Mmrn2 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MMRN2 mRNA CTD PMID:27858113 Mmrn2 Mouse decabromodiphenyl ether increases expression ISO MMRN2 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of MMRN2 protein CTD PMID:31675489 Mmrn2 Mouse dibenz[a,h]anthracene increases expression EXP 6480464 1 more ... CTD PMID:26377693 Mmrn2 Mouse dimethylselenide multiple interactions ISO MMRN2 (Homo sapiens) 6480464 [[Ozone results in increased oxidation of dimethylselenide] which results in increased expression of ADIRF-AS1 mRNA] which results in increased expression of MMRN2 mRNA CTD PMID:33656867 Mmrn2 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of MMRN2 mRNA CTD PMID:30319688 Mmrn2 Mouse folic acid decreases expression ISO MMRN2 (Homo sapiens) 6480464 Folic Acid results in decreased expression of MMRN2 mRNA CTD PMID:21867686 Mmrn2 Mouse furan increases methylation ISO Mmrn2 (Rattus norvegicus) 6480464 furan results in increased methylation of MMRN2 gene CTD PMID:22079235 Mmrn2 Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of MMRN2 mRNA CTD PMID:27339419 Mmrn2 Mouse lipopolysaccharide multiple interactions ISO MMRN2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Mmrn2 Mouse lipopolysaccharide decreases expression ISO MMRN2 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of MMRN2 mRNA CTD PMID:35811015 Mmrn2 Mouse mitomycin C increases expression EXP 6480464 Mitomycin results in increased expression of MMRN2 mRNA CTD PMID:25270620 Mmrn2 Mouse N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MMRN2 mRNA CTD PMID:17475336 Mmrn2 Mouse oxaliplatin multiple interactions ISO Mmrn2 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of MMRN2 mRNA CTD PMID:25729387 Mmrn2 Mouse ozone multiple interactions ISO MMRN2 (Homo sapiens) 6480464 [[Ozone results in increased oxidation of dimethylselenide] which results in increased expression of ADIRF-AS1 mRNA] which results in increased expression of MMRN2 mRNA CTD PMID:33656867 Mmrn2 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MMRN2 mRNA CTD PMID:34911549 Mmrn2 Mouse paracetamol decreases expression ISO MMRN2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MMRN2 mRNA CTD PMID:21420995 Mmrn2 Mouse perfluorooctanoic acid multiple interactions ISO Mmrn2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MMRN2 mRNA CTD PMID:35163327 Mmrn2 Mouse potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of MMRN2 mRNA CTD PMID:23608068 Mmrn2 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MMRN2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Mmrn2 Mouse silicon dioxide increases expression ISO MMRN2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of MMRN2 mRNA CTD PMID:25351596 Mmrn2 Mouse sodium arsenite increases expression ISO MMRN2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MMRN2 mRNA CTD PMID:29301061 Mmrn2 Mouse sulforaphane decreases expression ISO MMRN2 (Homo sapiens) 6480464 sulforaphane results in decreased expression of MMRN2 mRNA CTD PMID:31838189 Mmrn2 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MMRN2 mRNA CTD PMID:27858113 Mmrn2 Mouse titanium dioxide increases expression ISO MMRN2 (Homo sapiens) 6480464 titanium dioxide results in increased expression of MMRN2 mRNA CTD PMID:34973136 Mmrn2 Mouse topotecan multiple interactions ISO Mmrn2 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of MMRN2 mRNA CTD PMID:25729387 Mmrn2 Mouse triclosan decreases expression ISO MMRN2 (Homo sapiens) 6480464 Triclosan results in decreased expression of MMRN2 mRNA CTD PMID:30510588 Mmrn2 Mouse valproic acid affects expression ISO MMRN2 (Homo sapiens) 6480464 Valproic Acid affects the expression of MMRN2 mRNA CTD PMID:25979313 Mmrn2 Mouse valproic acid increases methylation ISO MMRN2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MMRN2 gene CTD PMID:29154799 Mmrn2 Mouse valproic acid increases expression ISO MMRN2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MMRN2 mRNA CTD PMID:28001369 Mmrn2 Mouse valproic acid decreases expression ISO Mmrn2 (Rattus norvegicus) 6480464 Valproic Acid results in decreased expression of MMRN2 mRNA CTD PMID:29427782
1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) bisphenol A (EXP) bisphenol F (EXP) carbon nanotube (EXP) chloroprene (EXP) chlorpyrifos (EXP) chrysene (EXP) decabromodiphenyl ether (ISO) dibenz[a,h]anthracene (EXP) dimethylselenide (ISO) ethanol (EXP) folic acid (ISO) furan (ISO) lipopolysaccharide (EXP,ISO) mitomycin C (EXP) N-methyl-4-phenylpyridinium (EXP) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) potassium dichromate (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (ISO) tetraphene (EXP) titanium dioxide (ISO) topotecan (ISO) triclosan (ISO) valproic acid (ISO)
Mmrn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 34,097,461 - 34,126,244 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 34,097,422 - 34,126,244 (+) Ensembl GRCm39 Ensembl GRCm38 14 34,375,504 - 34,404,287 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 34,375,465 - 34,404,287 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 35,188,690 - 35,217,473 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 33,204,621 - 33,232,834 (+) NCBI MGSCv36 mm8 Celera 14 30,641,747 - 30,669,702 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 20.81 NCBI
MMRN2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 86,935,540 - 86,957,615 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 86,935,540 - 86,969,481 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 88,695,297 - 88,717,372 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 88,685,576 - 88,707,352 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 88,685,575 - 88,707,352 NCBI Celera 10 82,698,335 - 82,720,425 (-) NCBI Celera Cytogenetic Map 10 q23.2 NCBI HuRef 10 82,549,122 - 82,571,213 (-) NCBI HuRef CHM1_1 10 88,977,037 - 88,999,158 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 87,819,295 - 87,841,328 (-) NCBI T2T-CHM13v2.0
Mmrn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 9,712,181 - 9,733,653 (+) NCBI GRCr8 mRatBN7.2 16 9,705,925 - 9,727,405 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 9,705,892 - 9,727,405 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 9,726,090 - 9,747,526 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 10,870,804 - 10,892,240 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 9,721,171 - 9,742,604 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 10,727,552 - 10,749,303 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 10,727,571 - 10,749,382 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 9,055,337 - 9,075,346 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 10,031,365 - 10,052,169 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 10,031,524 - 10,051,725 (+) NCBI Celera 16 5,489,507 - 5,510,959 (-) NCBI Celera Cytogenetic Map 16 p15 NCBI
Mmrn2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955510 5,945,043 - 5,958,352 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955510 5,943,126 - 5,957,679 (-) NCBI ChiLan1.0 ChiLan1.0
MMRN2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 98,930,555 - 98,966,505 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 98,935,874 - 98,971,822 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 83,363,696 - 83,396,966 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 86,920,521 - 86,956,333 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 86,920,521 - 86,942,777 (-) Ensembl panpan1.1 panPan2
MMRN2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 34,577,072 - 34,604,521 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 34,589,597 - 34,605,576 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 34,580,472 - 34,595,946 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 34,949,417 - 34,964,896 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 34,950,035 - 34,964,843 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 34,795,071 - 34,810,534 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 34,964,039 - 34,979,464 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 35,469,876 - 35,485,332 (-) NCBI UU_Cfam_GSD_1.0
Mmrn2
MMRN2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 87,896,074 - 87,916,342 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 87,891,585 - 87,916,327 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 95,292,539 - 95,308,417 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MMRN2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 44,913,403 - 44,934,430 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 44,913,455 - 44,935,112 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 5,020,595 - 5,042,314 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mmrn2
.
Predicted Target Of
Count of predictions: 320 Count of miRNA genes: 240 Interacting mature miRNAs: 268 Transcripts: ENSMUST00000111908 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 27226748 Femd8_m femur midshaft diameter 8, 10 week (mouse) 14 13769273 46737457 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 27226744 Metcl6_m metatarsal-calcaneal length 6, 5 week (mouse) 14 30321957 52937457 Mouse 27226775 Tibl7_m tibia length 7, 5 week (mouse) 14 30321957 48837457 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 4142485 Modor2_m modifier of ocular retardation 2 (mouse) Not determined 14 24926248 58179769 Mouse 27226737 Metcl12_m metatarsal-calcaneal length 12, 10 week (mouse) 14 33221957 59437449 Mouse 1301372 Sluc13_m susceptibility to lung cancer 13 (mouse) Not determined 14 18827604 52827726 Mouse 14696688 Rfq2_m rearing frequency QTL 2, males (mouse) 14 33721957 35721957 Mouse 4141550 Dbm3_m diabetes modifier 3 (mouse) Not determined 5143473 39143596 Mouse 1300544 Hypn_m hyperinsulinemia (mouse) Not determined 14 15160616 49160765 Mouse 1301991 Wta3_m weight adult 3 (mouse) Not determined 14 3887473 37887650 Mouse 1300998 Cia17_m collagen induced arthritis 17 (mouse) Not determined 14 30335250 64335381 Mouse 4141864 Mrdq4_m modifier of retinal degeneration QTL 4 (mouse) Not determined 9923245 48765082 Mouse 10043886 Cia49_m collagen induced arthritis QTL 49 (mouse) Not determined 14 29996994 63997133 Mouse 1300779 Dyscalc4_m dystrophic cardiac calcinosis 4 (mouse) Not determined 14 12212871 46213007 Mouse 27226727 Tibl21_m tibia length 21, 16 week (mouse) 14 34121957 52937457 Mouse 14746973 Manh76_m mandible shape 76 (mouse) 14 22287217 56287217 Mouse 1300909 Ath13_m atherosclerosis 13 (mouse) Not determined 14 30335250 64335381 Mouse 27226752 Femd4_m femur midshaft diameter 4, 5 week (mouse) 14 13769273 47237457 Mouse 13506929 Recrq10_m recombination rate in male meiosis QTL 10 (mouse) 14 27921957 61137449 Mouse
AA986839
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 34,403,601 - 34,403,714 UniSTS GRCm38 MGSCv37 14 35,216,787 - 35,216,900 UniSTS GRCm37 Celera 14 30,669,016 - 30,669,129 UniSTS Cytogenetic Map 14 B UniSTS Whitehead/MRC_RH 14 301.79 UniSTS
UniSTS:237166
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 34,402,988 - 34,403,227 UniSTS GRCm38 MGSCv37 14 35,216,174 - 35,216,413 UniSTS GRCm37 Celera 14 30,668,403 - 30,668,642 UniSTS Cytogenetic Map 14 B UniSTS
UniSTS:237167
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 34,404,060 - 34,404,268 UniSTS GRCm38 MGSCv37 14 35,217,246 - 35,217,454 UniSTS GRCm37 Celera 14 30,669,475 - 30,669,683 UniSTS Cytogenetic Map 14 B UniSTS
PMC262405P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 34,375,848 - 34,376,338 UniSTS GRCm38 MGSCv37 14 35,189,034 - 35,189,524 UniSTS GRCm37 Celera 14 30,642,091 - 30,642,581 UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 B-C UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000111908 ⟹ ENSMUSP00000107539
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 34,097,422 - 34,126,244 (+) Ensembl GRCm38.p6 Ensembl 14 34,375,465 - 34,404,287 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000227130 ⟹ ENSMUSP00000153972
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 34,097,678 - 34,119,885 (+) Ensembl GRCm38.p6 Ensembl 14 34,375,721 - 34,397,928 (+) Ensembl
RefSeq Acc Id:
NM_153127 ⟹ NP_694767
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 34,097,461 - 34,126,244 (+) NCBI GRCm38 14 34,375,504 - 34,404,287 (+) ENTREZGENE MGSCv37 14 35,188,690 - 35,217,473 (+) RGD Celera 14 30,641,747 - 30,669,702 (+) RGD cM Map 14 ENTREZGENE
Sequence:
TTTGTTGTCCTCGTGTTTTCTTTTCTTTCTGACATTTCGCTTGAAGACCACATCACCAGCAAATTTGAGAGTCACTTGTAAGGCTGAGCATCAGCACAGGAGCCCCTCACCATGATCCCGACACTGCT
hide sequence
RefSeq Acc Id:
NP_694767 ⟸ NM_153127
- Peptide Label:
precursor
- UniProtKB:
Q8BJX4 (UniProtKB/Swiss-Prot), Q8K1Z7 (UniProtKB/Swiss-Prot), A6H6E2 (UniProtKB/Swiss-Prot)
- Sequence:
MIPTLLLGFGVYLSWGLLGSWAQDPGTKFSHLNRPGMPEGWRLGAEDTSRDPIRRNWCPYQKSRLVTFVAACKTEKFLVHSQQPCPQGAPDCQGVRVMYRVAQKPVYQVQQKVLISVDWRCCPGFQGP
hide sequence
Ensembl Acc Id:
ENSMUSP00000107539 ⟸ ENSMUST00000111908
Ensembl Acc Id:
ENSMUSP00000153972 ⟸ ENSMUST00000227130
RGD ID: 8681934 Promoter ID: EPDNEW_M18998 Type: initiation region Name: Mmrn2_1 Description: Mus musculus multimerin 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 34,375,534 - 34,375,594 EPDNEW
