Advanced Search (OLGA)

Gene: Tmem270 (transmembrane protein 270) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Tmem270

Name:

transmembrane protein 270

RGD ID:

1321641

MGI Page

MGI

Description:

Predicted to be located in membrane. Orthologous to human TMEM270 (transmembrane protein 270).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1700111I05Rik; MGC141057; Wbscr; Wbscr28; Williams-Beuren syndrome chromosomal region 28 protein homolog; Williams-Beuren syndrome chromosome region 28; Williams-Beuren syndrome chromosome region 28 (human); Williams-Beuren syndrome critical region 28

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM270 (transmembrane protein 270)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tmem270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem270 (transmembrane protein 270)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tmem270 (transmembrane protein 270)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TMEM270 (transmembrane protein 270)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	134,930,447 - 134,935,587 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	134,930,447 - 134,935,587 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	134,901,593 - 134,906,733 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	134,901,593 - 134,906,733 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,377,464 - 135,382,603 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,186,221 - 135,191,360 (-)	NCBI		MGSCv36	mm8
Celera	5	131,912,152 - 131,917,291 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.88	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem270	Mouse	autism spectrum disorder		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:21658581 more ...
Tmem270	Mouse	autistic disorder		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Tmem270	Mouse	intestinal volvulus		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: INTESTINAL MALROTATION and FAMILIAL	ClinVar	PMID:25741868
Tmem270	Mouse	Neurodevelopmental Disorders		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Tmem270	Mouse	pleomorphic xanthoastrocytoma		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
Tmem270	Mouse	schizophrenia		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311
Tmem270	Mouse	supravalvular aortic stenosis		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Supravalvar aortic stenosis	ClinVar	PMID:10627943 more ...
Tmem270	Mouse	Volvulus Of Midgut		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Volvulus of midgut	ClinVar	PMID:25741868
Tmem270	Mouse	Williams-Beuren syndrome		ISO	TMEM270 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Williams syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem270	Mouse	17beta-hydroxy-5alpha-androstan-3-one	decreases expression	ISO	TMEM270 (Homo sapiens)	6480464	Dihydrotestosterone results in decreased expression of TMEM270 mRNA	CTD	PMID:17624924
Tmem270	Mouse	3,4-methylenedioxymethamphetamine	increases expression	EXP		6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TMEM270 mRNA	CTD	PMID:20188158
Tmem270	Mouse	6-propyl-2-thiouracil	increases expression	ISO	Tmem270 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of TMEM270 mRNA	CTD	PMID:24780913
Tmem270	Mouse	aflatoxin B1	decreases methylation	ISO	TMEM270 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of TMEM270 intron	CTD	PMID:30157460
Tmem270	Mouse	arsane	affects methylation	ISO	TMEM270 (Homo sapiens)	6480464	Arsenic affects the methylation of TMEM270 gene	CTD	PMID:25304211
Tmem270	Mouse	arsenic atom	affects methylation	ISO	TMEM270 (Homo sapiens)	6480464	Arsenic affects the methylation of TMEM270 gene	CTD	PMID:25304211
Tmem270	Mouse	benzo[a]pyrene	increases methylation	ISO	TMEM270 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of TMEM270 promoter	CTD	PMID:27901495
Tmem270	Mouse	benzo[e]pyrene	decreases methylation	ISO	TMEM270 (Homo sapiens)	6480464	benzo(e)pyrene results in decreased methylation of TMEM270 intron	CTD	PMID:30157460
Tmem270	Mouse	bisphenol A	decreases expression	ISO	Tmem270 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of TMEM270 mRNA	CTD	PMID:25181051 and PMID:30816183
Tmem270	Mouse	butanal	increases expression	ISO	TMEM270 (Homo sapiens)	6480464	butyraldehyde results in increased expression of TMEM270 mRNA	CTD	PMID:26079696
Tmem270	Mouse	cadmium dichloride	increases expression	ISO	TMEM270 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of TMEM270 mRNA	CTD	PMID:26472689
Tmem270	Mouse	cefaloridine	increases expression	ISO	Tmem270 (Rattus norvegicus)	6480464	Cephaloridine results in increased expression of TMEM270 mRNA	CTD	PMID:18500788
Tmem270	Mouse	CGP 52608	multiple interactions	ISO	TMEM270 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to TMEM270 gene]	CTD	PMID:28238834
Tmem270	Mouse	methapyrilene	decreases methylation	ISO	TMEM270 (Homo sapiens)	6480464	Methapyrilene results in decreased methylation of TMEM270 intron	CTD	PMID:30157460
Tmem270	Mouse	methoxychlor	affects methylation	ISO	Tmem270 (Rattus norvegicus)	6480464	Methoxychlor affects the methylation of TMEM270 gene	CTD	PMID:35440735
Tmem270	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of TMEM270 mRNA	CTD	PMID:17562736
Tmem270	Mouse	paracetamol	decreases expression	ISO	Tmem270 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of TMEM270 mRNA	CTD	PMID:33387578
Tmem270	Mouse	pentanal	increases expression	ISO	TMEM270 (Homo sapiens)	6480464	pentanal results in increased expression of TMEM270 mRNA	CTD	PMID:26079696
Tmem270	Mouse	permethrin	decreases expression	ISO	TMEM270 (Homo sapiens)	6480464	Permethrin results in decreased expression of TMEM270 mRNA	CTD	PMID:37047231
Tmem270	Mouse	propanal	increases expression	ISO	TMEM270 (Homo sapiens)	6480464	propionaldehyde results in increased expression of TMEM270 mRNA	CTD	PMID:26079696
Tmem270	Mouse	silicon dioxide	decreases expression	ISO	TMEM270 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of TMEM270 mRNA	CTD	PMID:25895662
Tmem270	Mouse	silver atom	increases expression	EXP		6480464	Silver results in increased expression of TMEM270 mRNA	CTD	PMID:27131904
Tmem270	Mouse	silver(0)	increases expression	EXP		6480464	Silver results in increased expression of TMEM270 mRNA	CTD	PMID:27131904
Tmem270	Mouse	sotorasib	multiple interactions	ISO	TMEM270 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of TMEM270 mRNA	CTD	PMID:36139627
Tmem270	Mouse	trametinib	multiple interactions	ISO	TMEM270 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of TMEM270 mRNA	CTD	PMID:36139627
Tmem270	Mouse	vinclozolin	increases methylation	ISO	Tmem270 (Rattus norvegicus)	6480464	vinclozolin results in increased methylation of TMEM270 gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem270	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem270	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015
Tmem270	Mouse	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	2290270		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem270	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11779826	PMID:12466851	PMID:12477932	PMID:16141072	PMID:16141073	PMID:21267068	PMID:31201419

Tmem270
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	134,930,447 - 134,935,587 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	134,930,447 - 134,935,587 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	134,901,593 - 134,906,733 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	134,901,593 - 134,906,733 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,377,464 - 135,382,603 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,186,221 - 135,191,360 (-)	NCBI		MGSCv36	mm8
Celera	5	131,912,152 - 131,917,291 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.88	NCBI

TMEM270
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,860,848 - 73,865,890 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,861,159 - 73,865,890 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	73,275,489 - 73,280,220 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,913,425 - 72,918,159 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	68,754,191 - 68,758,926 (+)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	69,158,848 - 69,163,564 (+)	NCBI		HuRef
CHM1_1	7	73,420,949 - 73,425,683 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	75,061,792 - 75,066,837 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,608,561 - 72,613,295 (+)	NCBI

Tmem270
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,430,092 - 27,435,243 (+)	NCBI		GRCr8
mRatBN7.2	12	21,793,631 - 21,798,723 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,794,130 - 21,798,731 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	12	24,803,204 - 24,808,287 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,803,686 - 24,808,288 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,803,487 - 26,808,557 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,858,647 - 22,863,206 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	23,554,551 - 23,559,628 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

Tmem270
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955456	13,947,773 - 13,953,965 (-)	NCBI	ChiLan1.0	ChiLan1.0

TMEM270
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,037,439 - 91,048,490 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,302,070 - 139,313,122 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	81,011,217 - 81,016,100 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	81,011,217 - 81,016,100 (+)	Ensembl	panpan1.1		panPan2

TMEM270
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,472,495 - 6,475,051 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	6,472,520 - 6,474,976 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,170,118 - 8,172,674 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,287,508 - 6,290,064 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,286,533 - 6,289,989 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,277,242 - 6,279,798 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,225,118 - 6,227,687 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,388,863 - 6,391,438 (-)	NCBI		UU_Cfam_GSD_1.0

Tmem270
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,029,940 - 131,032,296 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	3,004,326 - 3,006,608 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	3,004,326 - 3,006,608 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM270
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	11,075,901 - 11,078,442 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	11,059,177 - 11,079,858 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,752,341 - 10,768,852 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM270
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,212,358 - 9,217,628 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,212,377 - 9,217,517 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	7,273,087 - 7,296,893 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem270
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624740	14,017,188 - 14,021,587 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tmem270
260 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	205
Count of miRNA genes:	187
Interacting mature miRNAs:	192
Transcripts:	ENSMUST00000047305
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226719	Tibw6_m	tibia width 6, proximal, 16 week (mouse)					5	72857343	139985755	Mouse
1301715	Elmaz2_m	elevated maze behavior 2 (mouse)			Not determined		5	125178229	141700466	Mouse
10412191	Bbaa24_m	B.burgdorferi-associated arthritis 24 (mouse)			Not determined		5	119945037	141700466	Mouse
13464143	Bbaa2b_m	B.burgdorferi-associated arthritis 2b (mouse)					5	133052969	140709801	Mouse
11528552	Scram1_m	spinal cord resistance to astrocytoma modifier 1 (mouse)					5	121455402	151758149	Mouse
1300827	Cora1_m	correlation in cytokine production 1 (mouse)			Not determined		5	115156883	149157015	Mouse
14746986	Manh58_m	mandible shape 58 (mouse)					5	102446283	136446283	Mouse
10412239	Alpq7_m	alcohol preference QTL 7 (mouse)			Not determined		5	104705939	138705939	Mouse
12880406	Jcdq2_m	joint cartilage degeneration QTL 2 (mouse)					5	129787831	151758149	Mouse
4141218	Ath24_m	atherosclerosis 24 (mouse)			Not determined			129520084	151758149	Mouse
12859290	Criq2_m	Citrobacter rodentium infection QTL 2 (mouse)					5	101332579	135332579	Mouse
1301363	Pbwg13_m	postnatal body weight growth 13 (mouse)			Not determined		5	125133457	151758149	Mouse
1301362	Prnr1_m	prion resistance 1 (mouse)			Not determined		5	89418876	146787935	Mouse
1300913	Bwefm_m	body weight females and males day 10 (mouse)			Not determined		5	109439348	143439459	Mouse
4141081	Nidd7k_m	Nidd7 on KK-A (mouse)			Not determined			119945037	149347326	Mouse
1301624	Aevm2_m	autoimmune extremity vasculitis in MRL mice 2 (mouse)			Not determined		5	101863832	135864028	Mouse
10043890	Trigq4_m	triglyceride QTL 4 (mouse)			Not determined		5	107906299	141906412	Mouse
1302079	Lbw3_m	lupus NZB x NZW 3 (mouse)			Not determined		5	124700335	151758149	Mouse
11532736	Sluc33b_m	susceptibility to lung cancer 33b (mouse)					5	102945037	136945196	Mouse
1301986	Bpq4_m	blood pressure QTL 4 (mouse)			Not determined		5	121555236	151758149	Mouse
1301857	Bglq14_m	body growth late QTL 14 (mouse)			Not determined		5	118948964	151758149	Mouse
10412202	Bbaa26_m	B.burgdorferi-associated arthritis 26 (mouse)			Not determined		5	104583688	138555455	Mouse
1301543	Hypch_m	hypercholesterolemia (mouse)			Not determined		5	109238624	139118905	Mouse
4142473	Chlq11_m	circulating hormone level QTL 11 (mouse)			Not determined		5	107906299	141906412	Mouse
13464251	Ahl21_m	age related hearing loss, early onset 21 (mouse)					5	109167240	143167381	Mouse
11341716	Rvfs3_m	Rift Valley fever susceptibility 3 (mouse)					5	26441234	138455402	Mouse
1301226	Bbaa2_m	B.burgdorferi-associated arthritis 2 (mouse)			Not determined		5	115156883	149157015	Mouse
10412197	Bbaa25_m	B.burgdorferi-associated arthritis 25 (mouse)			Not determined		5	109167240	143167381	Mouse
1301102	Cia14_m	collagen induced arthritis 14 (mouse)			Not determined		5	113320385	138555455	Mouse
11049557	Lmr26_m	leishmaniasis resistance 26 (mouse)					5	133925558	151758149	Mouse
13464243	Ahl20_m	age related hearing loss, early onset 20 (mouse)					5	107906299	141906412	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_029681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_194065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC079938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK007170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AV209462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY369079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY369080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC114542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000047305 ⟹ ENSMUSP00000045190

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	134,930,448 - 134,935,587 (-)	Ensembl
GRCm38.p6 Ensembl	5	134,901,594 - 134,906,733 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000201316 ⟹ ENSMUSP00000144496

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	134,930,447 - 134,935,587 (-)	Ensembl
GRCm38.p6 Ensembl	5	134,901,593 - 134,906,733 (-)	Ensembl

RefSeq Acc Id:

NM_029681 ⟹ NP_083957

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	134,930,447 - 134,935,587 (-)	NCBI
GRCm38	5	134,901,593 - 134,906,733 (-)	NCBI
MGSCv37	5	135,377,464 - 135,382,603 (-)	RGD
Celera	5	131,912,151 - 131,917,291 (-)	NCBI
cM Map	5		ENTREZGENE

Sequence:

show sequence

CTCTCCTGGCTGGAGGAATGGGTGGAGGCCAGACATGGAGGCCGCTCCCCGGGTCAGATCTGGCCTTCTCAGAATTCTTCTGCGGGCTGGGAGGCTCTCTGCACTGCTGATCCAGAACCGCACTCACT
TGTACCGCTTTCTGCTCCTGAAGATGGCCATCTTTCAGCACTGGGTGTTGGGGCTGGCCCAGGAAGCCCGGGGTTCAGGCAGTGACCAGGCCCGCCAGCTTCCGGAAGTCATCATAACCTGTGCTCTG
AGTTTGGCCCTTCGAGCTGGACTAACATTGCTGTGGGTCCCCATGTGGCTGCTGCTCTGGGGACCCAGGCTGGCATACAGAGTCGGGCTGTGCTGCACTCGTACTGTGAGGTTGGCCCTGGGGCATCT
CTGTGTCTGTGAACCTCTCGGTCTGTCTCCAGCCACCTTCAGGGACCTGTTTCTATCCTGCCTGCACAGCCTGATGCTGGTAGCTTTGCTGCTGCTGCTGCTAACCTGGAAGCTGATGCAGAAAGCCC
ATCACTTTAGTCTGGGCTGGCTGCCCAGTCAGGGCTGGGGCCGGGGCTCAAACTTGGCCGACTTGAGCCATCCTTCCAGTCCTTACCAATGCTCTTGCCTGGCCGGACCCTCCTGCAGAATTCTGTGT
TGCTGGAAGCCCCGGCCCTGCTGAGACGCCTCTACCTGTGGGTGGAACACAGGACCACACTCACTTCCTGGAACCTGGCCTATCTTGTCACTTGGACGACCTGCCTTGCTTCCCACCTGCTTCAAGCT
GCCTTTGAACACACAACCCAACTGGCCCAGGCCCAGGAAGTCAAATCCCAGGAGACCTCGGGGCCCCCGCCTCAGTTCTTAATTCCAGAATCCTCCACCACTGAGTCTGGACCCCTCCCACCCCAGCC
TGAAACCCCTGGAGAATAAATGTGTCCCCCACCTGCC

hide sequence

RefSeq Acc Id:

NM_194065 ⟹ NP_919041

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	134,930,447 - 134,935,587 (-)	NCBI
GRCm38	5	134,901,593 - 134,906,733 (-)	NCBI
MGSCv37	5	135,377,464 - 135,382,603 (-)	RGD
Celera	5	131,912,151 - 131,917,291 (-)	NCBI
cM Map	5		ENTREZGENE

Sequence:

show sequence

CTCTCCTGGCTGGAGGAATGGGTGGAGGCCAGACATGGAGGCCGCTCCCCGGGTCAGATCTGGC
CTTCTCAGAATTCTTCTGCGGGCTGGGAGGCTCTCTGCACTGCTGATCCAGAACCGCACTCACTTGTACCGCTTTCTGCTCCTGAAGATGGCCATCTTTCAGCACTGGGTGTTGGGGCTGGCCCAGGA
AGCCCGGGGTTCAGGCAGTGACCAGGCCCGCCAGCTTCCGGAAGTCATCATAACCTGTGCTCTGAGTTTGGCCCTTCGAGCTGGACTAACATTGCTGTGGGTCCCCATGTGGCTGCTGCTCTGGGGAC
CCAGGCTGGCATACAGAGTCGGGCTGTGCTGCACTCGTACTGTGAGGTTGGCCCTGGGGCATCTCTGTGTCTGTGAACCTCTCGGTCTGTCTCCAGCCACCTTCAGGGACCTGTTTCTATCCTGCCTG
CACAGCCTGATGCTGGTAGCTTTGCTGCTGCTGCTGCTAACCTGGAAGCTGATGCAGAAAGCCCATCACTTTAGTCTGGGCTGGCTGCCCAGTCAGAATTCTGTGTTGCTGGAAGCCCCGGCCCTGCT
GAGACGCCTCTACCTGTGGGTGGAACACAGGACCACACTCACTTCCTGGAACCTGGCCTATCTTGTCACTTGGACGACCTGCCTTGCTTCCCACCTGCTTCAAGCTGCCTTTGAACACACAACCCAAC
TGGCCCAGGCCCAGGAAGTCAAATCCCAGGAGACCTCGGGGCCCCCGCCTCAGTTCTTAATTCCAGAATCCTCCACCACTGAGTCTGGACCCCTCCCACCCCAGCCTGAAACCCCTGGAGAATAAATG
TGTCCCCCACCTGCC

hide sequence


Protein RefSeqs	NP_083957	(Get FASTA)	NCBI Sequence Viewer
	NP_919041	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI14543	(Get FASTA)	NCBI Sequence Viewer
	AAQ67392	(Get FASTA)	NCBI Sequence Viewer
	AAQ67393	(Get FASTA)	NCBI Sequence Viewer
	BAB24883	(Get FASTA)	NCBI Sequence Viewer
	EDL19411	(Get FASTA)	NCBI Sequence Viewer
	EDL19412	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000045190
	ENSMUSP00000045190.6
	ENSMUSP00000144496
	ENSMUSP00000144496.2
GenBank Protein	Q6UJB9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_083957 ⟸ NM_029681
- Peptide Label:	isoform b
- UniProtKB:	Q6UJB9 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEAAPRVRSGLLRILLRAGRLSALLIQNRTHLYRFLLLKMAIFQHWVLGLAQEARGSGSDQARQLPEVIITCALSLALRAGLTLLWVPMWLLLWGPRLAYRVGLCCTRTVRLALGHLCVCEPLGLSPA TFRDLFLSCLHSLMLVALLLLLLTWKLMQKAHHFSLGWLPSQGWGRGSNLADLSHPSSPYQCSCLAGPSCRILCCWKPRPC hide sequence

RefSeq Acc Id:	NP_919041 ⟸ NM_194065
- Peptide Label:	isoform a
- UniProtKB:	Q9D9B5 (UniProtKB/Swiss-Prot), Q6UJB9 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEAAPRVRSGLLRILLRAGRLSALLIQNRTHLYRFLLLKMAIFQHWVLGLAQEARGSGSDQARQLPEVIITCALSLALRAGLTLLWVPMWLLLWGPRLAYRVGLCCTRTVRLALGHLCVCEPLGLSPA TFRDLFLSCLHSLMLVALLLLLLTWKLMQKAHHFSLGWLPSQNSVLLEAPALLRRLYLWVEHRTTLTSWNLAYLVTWTTCLASHLLQAAFEHTTQLAQAQEVKSQETSGPPPQFLIPESSTTESGPLP PQPETPGE hide sequence

Ensembl Acc Id:

ENSMUSP00000045190 ⟸ ENSMUST00000047305

Ensembl Acc Id:

ENSMUSP00000144496 ⟸ ENSMUST00000201316

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6UJB9-F1-model_v2	AlphaFold	Q6UJB9	1-264	view protein structure

RGD ID:

6888274

Promoter ID:

EPDNEW_M7588

Type:

multiple initiation site

Name:

Tmem270_1

Description:

Mus musculus transmembrane protein 270 , transcript variant 1,mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	5	134,906,733 - 134,906,793	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000040576	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000047305	ENTREZGENE
	ENSMUST00000047305.6	UniProtKB/Swiss-Prot
	ENSMUST00000201316	ENTREZGENE
	ENSMUST00000201316.4	UniProtKB/Swiss-Prot
InterPro	WBS28	UniProtKB/Swiss-Prot
KEGG Report	mmu:76629	UniProtKB/Swiss-Prot
MGD	MGI:1923879	ENTREZGENE
NCBI Gene	76629	ENTREZGENE
PANTHER	PTHR37369	UniProtKB/Swiss-Prot
	TRANSMEMBRANE PROTEIN 270	UniProtKB/Swiss-Prot
Pfam	WBS28	UniProtKB/Swiss-Prot
PhenoGen	Tmem270	PhenoGen
UniProt	Q6UJB9	ENTREZGENE
	Q9D9B5	ENTREZGENE
	TM270_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q9D9B5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-22	Tmem270	transmembrane protein 270	Wbscr28	Williams-Beuren syndrome chromosome region 28 (human)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar