Symbol:
Cpne2
Name:
copine II
RGD ID:
1319356
MGI Page
MGI
Description:
Predicted to enable calcium-dependent phospholipid binding activity. Involved in cellular response to calcium ion. Located in cytoplasm; nucleus; and plasma membrane. Is expressed in brain and spinal cord ventricular layer. Orthologous to human CPNE2 (copine 2).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
3322401K10Rik; copine 2; copine-2; MGC30751; MGC37787; RIKEN cDNA 3322401K10 gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CPNE2 (copine 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cpne2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cpne2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CPNE2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CPNE2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cpne2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CPNE2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CPNE2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cpne2 (copine 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CPNE3 (copine 3) HGNC
OrthoMCL
Homo sapiens (human):
CPNE1 (copine 1) HGNC
OrthoMCL
Alliance orthologs 3
Homo sapiens (human):
CPNE2 (copine 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Cpne2 (copine 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cpne2 (copine II)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
gem-4
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
nra-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 95,259,299 - 95,297,157 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 95,259,618 - 95,297,159 (+) Ensembl GRCm39 Ensembl GRCm38 8 94,532,674 - 94,570,529 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 94,532,990 - 94,570,531 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 97,056,928 - 97,094,429 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 97,422,157 - 97,459,658 (+) NCBI MGSCv36 mm8 Celera 8 98,866,664 - 98,904,195 (+) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 46.55 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cpne2 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CPNE2 mRNA CTD PMID:36331819 Cpne2 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CPNE2 mRNA CTD PMID:22206623 Cpne2 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CPNE2 mRNA CTD PMID:17942748 Cpne2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CPNE2 mRNA CTD PMID:39298647 Cpne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CPNE2 mRNA CTD PMID:17942748 Cpne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cpne2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CPNE2 mRNA CTD PMID:32277265 Cpne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cpne2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPNE2 mRNA CTD PMID:32109520 Cpne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CPNE2 mRNA CTD PMID:21570461 and PMID:26377647 Cpne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPNE2 mRNA CTD PMID:26290441 Cpne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CPNE2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CPNE2 mRNA CTD PMID:20106945 and PMID:21632981 Cpne2 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Cpne2 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Cpne2 Mouse 2-palmitoylglycerol increases expression ISO CPNE2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of CPNE2 mRNA CTD PMID:37199045 Cpne2 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of CPNE2 mRNA CTD PMID:30951980 Cpne2 Mouse 4,4'-sulfonyldiphenol affects expression EXP 6480464 bisphenol S affects the expression of CPNE2 mRNA CTD PMID:39298647 Cpne2 Mouse acetamide increases expression ISO Cpne2 (Rattus norvegicus) 6480464 acetamide results in increased expression of CPNE2 mRNA CTD PMID:31881176 Cpne2 Mouse aflatoxin B1 increases methylation ISO CPNE2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CPNE2 gene CTD PMID:27153756 Cpne2 Mouse aflatoxin B1 affects methylation ISO CPNE2 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of CPNE2 intron CTD PMID:30157460 Cpne2 Mouse all-trans-retinoic acid decreases expression ISO CPNE2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CPNE2 mRNA CTD PMID:21934132 and PMID:33167477 Cpne2 Mouse alpha-Zearalanol multiple interactions ISO Cpne2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CPNE2 mRNA CTD PMID:35163327 Cpne2 Mouse belinostat decreases expression ISO CPNE2 (Homo sapiens) 6480464 belinostat results in decreased expression of CPNE2 mRNA CTD PMID:27188386 Cpne2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of CPNE2 mRNA CTD PMID:22228805 Cpne2 Mouse benzo[a]pyrene decreases methylation ISO CPNE2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CPNE2 3' UTR and Benzo(a)pyrene results in decreased methylation of CPNE2 promoter CTD PMID:27901495 Cpne2 Mouse benzo[e]pyrene increases methylation ISO CPNE2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CPNE2 intron CTD PMID:30157460 Cpne2 Mouse bisphenol A affects expression ISO Cpne2 (Rattus norvegicus) 6480464 bisphenol A affects the expression of CPNE2 mRNA CTD PMID:25181051 Cpne2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CPNE2 mRNA CTD PMID:32156529 Cpne2 Mouse bisphenol A decreases methylation ISO CPNE2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CPNE2 gene CTD PMID:31601247 Cpne2 Mouse bisphenol A decreases expression ISO Cpne2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CPNE2 mRNA CTD PMID:30816183 more ... Cpne2 Mouse bisphenol A increases methylation ISO Cpne2 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of CPNE2 gene CTD PMID:28505145 Cpne2 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of CPNE2 mRNA CTD PMID:38685157 Cpne2 Mouse cadmium atom multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CPNE2 mRNA CTD PMID:35301059 Cpne2 Mouse cadmium dichloride multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CPNE2 mRNA CTD PMID:35301059 Cpne2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Cpne2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of CPNE2 mRNA CTD PMID:25620056 Cpne2 Mouse corosolic acid increases expression ISO CPNE2 (Homo sapiens) 6480464 corosolic acid results in increased expression of CPNE2 mRNA CTD PMID:37939859 Cpne2 Mouse Cuprizon increases expression ISO Cpne2 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of CPNE2 mRNA CTD PMID:26577399 Cpne2 Mouse cyclosporin A increases expression ISO CPNE2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CPNE2 mRNA CTD PMID:20106945 and PMID:25562108 Cpne2 Mouse decabromodiphenyl ether increases expression ISO Cpne2 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of CPNE2 mRNA CTD PMID:23640034 Cpne2 Mouse diazinon increases methylation ISO CPNE2 (Homo sapiens) 6480464 Diazinon results in increased methylation of CPNE2 gene CTD PMID:22964155 Cpne2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CPNE2 mRNA CTD PMID:30529165 Cpne2 Mouse dorsomorphin multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CPNE2 mRNA CTD PMID:27188386 Cpne2 Mouse doxorubicin decreases expression ISO CPNE2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CPNE2 mRNA CTD PMID:29803840 Cpne2 Mouse entinostat increases expression ISO CPNE2 (Homo sapiens) 6480464 entinostat results in increased expression of CPNE2 mRNA CTD PMID:27188386 Cpne2 Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of CPNE2 mRNA CTD PMID:34813904 Cpne2 Mouse gentamycin decreases expression ISO Cpne2 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of CPNE2 mRNA CTD PMID:33387578 Cpne2 Mouse ivermectin decreases expression ISO CPNE2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CPNE2 protein CTD PMID:32959892 Cpne2 Mouse lead diacetate decreases expression ISO CPNE2 (Homo sapiens) 6480464 lead acetate results in decreased expression of CPNE2 mRNA CTD PMID:38568856 Cpne2 Mouse lipopolysaccharide multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of CPNE2 mRNA CTD PMID:35811015 Cpne2 Mouse methapyrilene increases methylation ISO CPNE2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CPNE2 intron CTD PMID:30157460 Cpne2 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of CPNE2 mRNA CTD PMID:34813904 Cpne2 Mouse monosodium L-glutamate increases expression EXP 6480464 Sodium Glutamate results in increased expression of CPNE2 mRNA CTD PMID:22078008 Cpne2 Mouse N-methyl-4-phenylpyridinium increases expression ISO CPNE2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CPNE2 mRNA CTD PMID:24810058 Cpne2 Mouse O-methyleugenol increases expression ISO CPNE2 (Homo sapiens) 6480464 methyleugenol results in increased expression of CPNE2 mRNA CTD PMID:32234424 Cpne2 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CPNE2 mRNA CTD PMID:34911549 Cpne2 Mouse paracetamol decreases expression ISO CPNE2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CPNE2 mRNA CTD PMID:21420995 Cpne2 Mouse paracetamol increases expression ISO CPNE2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CPNE2 mRNA CTD PMID:22230336 Cpne2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CPNE2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of CPNE2 mRNA CTD PMID:36331819 Cpne2 Mouse perfluorooctanoic acid multiple interactions ISO Cpne2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CPNE2 mRNA CTD PMID:35163327 Cpne2 Mouse perfluorooctanoic acid decreases expression ISO CPNE2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of CPNE2 mRNA CTD PMID:36326898 Cpne2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of CPNE2 mRNA CTD PMID:18301758 Cpne2 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of CPNE2 mRNA CTD PMID:17426115 Cpne2 Mouse potassium chromate decreases expression ISO CPNE2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CPNE2 mRNA CTD PMID:22714537 Cpne2 Mouse quercetin increases expression ISO CPNE2 (Homo sapiens) 6480464 Quercetin results in increased expression of CPNE2 mRNA CTD PMID:21632981 Cpne2 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of CPNE2 mRNA CTD PMID:35811015 Cpne2 Mouse SB 431542 multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CPNE2 mRNA CTD PMID:27188386 Cpne2 Mouse sodium arsenite affects expression ISO CPNE2 (Homo sapiens) 6480464 sodium arsenite affects the expression of CPNE2 mRNA CTD PMID:34032870 Cpne2 Mouse sodium arsenite decreases expression ISO CPNE2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CPNE2 mRNA and sodium arsenite results in decreased expression of CPNE2 protein CTD PMID:30528433 and PMID:38568856 Cpne2 Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of CPNE2 mRNA CTD PMID:21641980 Cpne2 Mouse sunitinib decreases expression ISO CPNE2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CPNE2 mRNA CTD PMID:31533062 Cpne2 Mouse tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of CPNE2 mRNA CTD PMID:25123088 Cpne2 Mouse thiram decreases expression ISO CPNE2 (Homo sapiens) 6480464 Thiram results in decreased expression of CPNE2 mRNA CTD PMID:38568856 Cpne2 Mouse trichostatin A decreases expression ISO CPNE2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CPNE2 mRNA CTD PMID:24935251 and PMID:26272509 Cpne2 Mouse trichostatin A multiple interactions ISO CPNE2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CPNE2 mRNA CTD PMID:27188386 Cpne2 Mouse triphenyl phosphate affects expression ISO CPNE2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CPNE2 mRNA CTD PMID:37042841 Cpne2 Mouse valproic acid increases methylation ISO CPNE2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CPNE2 gene CTD PMID:29154799 Cpne2 Mouse valproic acid decreases expression ISO CPNE2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CPNE2 mRNA CTD PMID:29154799 Cpne2 Mouse valproic acid affects expression ISO CPNE2 (Homo sapiens) 6480464 Valproic Acid affects the expression of CPNE2 mRNA CTD PMID:25979313
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (EXP) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (ISO) belinostat (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) corosolic acid (ISO) Cuprizon (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diazinon (ISO) dioxygen (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) fenthion (EXP) gentamycin (ISO) ivermectin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methidathion (EXP) monosodium L-glutamate (EXP) N-methyl-4-phenylpyridinium (ISO) O-methyleugenol (ISO) ozone (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) pirinixic acid (EXP) potassium chromate (ISO) quercetin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) succimer (EXP) sunitinib (ISO) tamoxifen (EXP) thiram (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Cpne2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 95,259,299 - 95,297,157 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 95,259,618 - 95,297,159 (+) Ensembl GRCm39 Ensembl GRCm38 8 94,532,674 - 94,570,529 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 94,532,990 - 94,570,531 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 97,056,928 - 97,094,429 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 97,422,157 - 97,459,658 (+) NCBI MGSCv36 mm8 Celera 8 98,866,664 - 98,904,195 (+) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 46.55 NCBI
CPNE2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 57,092,583 - 57,148,369 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 57,092,583 - 57,148,369 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 57,126,495 - 57,182,281 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 55,684,011 - 55,739,377 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 55,684,010 - 55,739,377 NCBI Celera 16 41,626,325 - 41,681,691 (+) NCBI Celera Cytogenetic Map 16 q13 NCBI HuRef 16 42,996,323 - 43,051,749 (+) NCBI HuRef CHM1_1 16 58,533,918 - 58,589,365 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 62,888,853 - 62,944,643 (+) NCBI T2T-CHM13v2.0
Cpne2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 10,440,245 - 10,477,783 (-) NCBI GRCr8 mRatBN7.2 19 10,434,277 - 10,472,146 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 10,434,277 - 10,471,820 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 10,397,954 - 10,420,348 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 11,164,809 - 11,187,203 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 10,451,764 - 10,474,163 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,860,963 - 10,898,970 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,861,406 - 10,884,047 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,855,268 - 10,877,311 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,876,907 - 10,885,628 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 10,323,757 - 10,345,868 (-) NCBI Celera Cytogenetic Map 19 p13 NCBI
Cpne2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 14,769,798 - 14,808,916 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 14,766,247 - 14,808,916 (+) NCBI ChiLan1.0 ChiLan1.0
CPNE2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 66,564,565 - 66,620,380 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 72,485,349 - 72,541,164 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 37,369,694 - 37,426,177 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 56,517,092 - 56,558,834 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 56,517,092 - 56,558,834 (+) Ensembl panpan1.1 panPan2
CPNE2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 59,226,410 - 59,257,170 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 59,226,410 - 59,259,900 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 55,854,566 - 55,900,418 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 59,764,707 - 59,810,534 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 59,764,707 - 59,810,641 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 56,595,980 - 56,641,808 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 57,603,332 - 57,649,143 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 58,497,441 - 58,543,263 (-) NCBI UU_Cfam_GSD_1.0
Cpne2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 50,326,487 - 50,351,161 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 9,226,572 - 9,262,856 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 9,237,845 - 9,262,588 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CPNE2
CPNE2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 43,043,433 - 43,100,132 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 43,062,679 - 43,101,872 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 33,220,085 - 33,275,880 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cpne2
.
Predicted Target Of
Count of predictions: 852 Count of miRNA genes: 409 Interacting mature miRNAs: 468 Transcripts: ENSMUST00000048653, ENSMUST00000109537, ENSMUST00000136550, ENSMUST00000156377, ENSMUST00000156894 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10043992 Hbnr11_m Heligmosomoides bakeri nematode resistance 11 (mouse) Not determined 8 66326836 100326976 Mouse 14696809 Rbcn3_m rod bipolar cell number 3 (mouse) 8 95056628 102856632 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1357787 Vtbt5_m vertebral trabecular bone trait 5 (mouse) Not determined 8 66084397 100084549 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 4141285 Tgq18_m triglyceride QTL 18 (mouse) Not determined 64186736 98186736 Mouse 4141797 Skmw16_m skeletal muscle weight 16 (mouse) Not determined 8 64666176 98666325 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1301872 Cd4ts3_m CD4 T cell subset 3 (mouse) Not determined 8 72122809 106123021 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1301688 Orch6_m autoimmune orchitis resistance 6 (mouse) Not determined 8 61513479 95513605 Mouse 1558780 Idd22_m insulin dependent diabetes susceptibility 22 (mouse) Not determined 8 71829531 105829637 Mouse 1300920 Pitm3_m prion incubation time 3 (mouse) Not determined 8 73929123 107929226 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
D8Mit182
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 94,559,987 - 94,560,125 UniSTS GRCm38 MGSCv37 8 97,083,887 - 97,084,025 UniSTS GRCm37 Celera 8 98,893,652 - 98,893,788 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS Whitehead Genetic 8 44.8 UniSTS Whitehead/MRC_RH 8 1158.74 UniSTS
STS-F03992
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 94,570,197 - 94,570,280 UniSTS GRCm38 MGSCv37 8 97,094,097 - 97,094,180 UniSTS GRCm37 Celera 8 98,903,863 - 98,903,946 UniSTS Cytogenetic Map 8 C5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000048653 ⟹ ENSMUSP00000045755
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 95,259,618 - 95,297,159 (+) Ensembl GRCm38.p6 Ensembl 8 94,532,990 - 94,570,531 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000109537 ⟹ ENSMUSP00000105163
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 95,259,695 - 95,297,018 (+) Ensembl GRCm38.p6 Ensembl 8 94,533,067 - 94,570,390 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000136550
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 95,259,695 - 95,276,451 (+) Ensembl GRCm38.p6 Ensembl 8 94,533,067 - 94,549,823 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156377
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 95,289,278 - 95,296,742 (+) Ensembl GRCm38.p6 Ensembl 8 94,562,650 - 94,570,114 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156894
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 95,259,667 - 95,275,455 (+) Ensembl GRCm38.p6 Ensembl 8 94,533,039 - 94,548,827 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212550 ⟹ ENSMUSP00000148447
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 95,282,142 - 95,290,684 (+) Ensembl GRCm38.p6 Ensembl 8 94,555,514 - 94,564,056 (+) Ensembl
RefSeq Acc Id:
NM_153507 ⟹ NP_705727
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 95,259,656 - 95,297,157 (+) NCBI GRCm38 8 94,533,028 - 94,570,529 (+) NCBI MGSCv37 8 97,056,928 - 97,094,429 (+) RGD Celera 8 98,866,664 - 98,904,195 (+) RGD cM Map 8 ENTREZGENE
Sequence:
CGCAGCCGGGGCCCGAGGAGGGCCAGCCCCAGCCCGGGCGAGCGCACGAGTGGGTACGGCCGCGCGGGTAGCGCCCTGAGCCTGTCCCGCGCCGCCGCCCGGCCGACAGCACAGCGCCCGGGGATGCC
hide sequence
RefSeq Acc Id:
XM_017312732 ⟹ XP_017168221
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 95,259,299 - 95,286,791 (+) NCBI GRCm38 8 94,532,674 - 94,560,163 (+) NCBI
Sequence:
GGGCGTCTCCCCGAGGATTCCGTGCTGAGCCCTGCGCGCTTTAGGGTGAGAGCCGCGGGCGGCG
hide sequence
RefSeq Acc Id:
NP_705727 ⟸ NM_153507
- UniProtKB:
Q8K1D7 (UniProtKB/Swiss-Prot), P59108 (UniProtKB/Swiss-Prot), A0A0R4J1D0 (UniProtKB/TrEMBL)
- Sequence:
MAYIPDGGAPTAGAIPLGSQCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAVNNLNPAFSKKFVLDYHFEEVQKLKFALFDQDKSSAQLDEHDFLGQFSCSLGTIVSSKKIT
hide sequence
RefSeq Acc Id:
XP_017168221 ⟸ XM_017312732
- Peptide Label:
isoform X1
- Sequence:
MAYIPDGGAPTAGAIPLGSQCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRT
hide sequence
Ensembl Acc Id:
ENSMUSP00000045755 ⟸ ENSMUST00000048653
Ensembl Acc Id:
ENSMUSP00000105163 ⟸ ENSMUST00000109537
Ensembl Acc Id:
ENSMUSP00000148447 ⟸ ENSMUST00000212550
RGD ID: 8667943 Promoter ID: EPDNEW_M11981 Type: initiation region Name: Cpne2_1 Description: Mus musculus copine II , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 94,533,058 - 94,533,118 EPDNEW
RGD ID: 6842968 Promoter ID: MM_KWN:55340 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000109537, OTTMUST00000057034, OTTMUST00000057038, UC009MWL.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 97,056,631 - 97,057,131 (+) MPROMDB
RGD ID: 6842970 Promoter ID: MM_KWN:55341 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Spleen Transcripts: OTTMUST00000057037 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 97,086,336 - 97,086,836 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-05
Cpne2
copine II
3322401K10Rik
RIKEN cDNA 3322401K10 gene
Data merged from RGD:1609987
737654 PROVISIONAL
