Advanced Search (OLGA)

Gene: 4921524J17Rik (RIKEN cDNA 4921524J17 gene) Mus musculus

Subscribe to Updates

Analyze

Symbol:

4921524J17Rik

Name:

RIKEN cDNA 4921524J17 gene

RGD ID:

1318634

MGI Page

MGI

Description:

Is expressed in several structures, including alimentary system; embryo mesenchyme; forebrain; musculoskeletal system; and sensory organ. Orthologous to human C16orf87 (chromosome 16 open reading frame 87).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC66714; UPF0547 protein C16orf87 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	86,135,388 - 86,159,470 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	86,135,388 - 86,159,462 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	85,408,759 - 85,432,841 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	85,408,759 - 85,432,833 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,932,658 - 87,956,740 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	88,298,864 - 88,322,938 (-)	NCBI		MGSCv36	mm8
Celera	8	89,703,821 - 89,727,627 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.61	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4921524J17Rik	Mouse	glycogen storage disease IXB		ISO	C16orf87 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glycogen storage disease IXb	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4921524J17Rik	Mouse	(+)-schisandrin B	multiple interactions	ISO	C19h16orf87 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of C19H16ORF87 mRNA]	CTD	PMID:31150632
4921524J17Rik	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	C19h16orf87 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of C19H16ORF87 mRNA	CTD	PMID:21215274
4921524J17Rik	Mouse	2-hydroxypropanoic acid	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of C16ORF87 mRNA	CTD	PMID:30851411
4921524J17Rik	Mouse	antirheumatic drug	increases expression	ISO	C16orf87 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of C16ORF87 mRNA	CTD	PMID:24449571
4921524J17Rik	Mouse	arsane	affects methylation	ISO	C16orf87 (Homo sapiens)	6480464	Arsenic affects the methylation of C16ORF87 gene	CTD	PMID:25304211
4921524J17Rik	Mouse	arsane	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of C16ORF87 mRNA	CTD	PMID:39836092
4921524J17Rik	Mouse	arsenic atom	affects methylation	ISO	C16orf87 (Homo sapiens)	6480464	Arsenic affects the methylation of C16ORF87 gene	CTD	PMID:25304211
4921524J17Rik	Mouse	arsenic atom	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of C16ORF87 mRNA	CTD	PMID:39836092
4921524J17Rik	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20018196
4921524J17Rik	Mouse	bisphenol A	increases expression	ISO	C19h16orf87 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of C16ORF87 mRNA	CTD	PMID:25181051
4921524J17Rik	Mouse	bisphenol A	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of C16ORF87 gene	CTD	PMID:31601247
4921524J17Rik	Mouse	butanal	increases expression	ISO	C16orf87 (Homo sapiens)	6480464	butyraldehyde results in increased expression of C16ORF87 mRNA	CTD	PMID:26079696
4921524J17Rik	Mouse	coumarin	increases phosphorylation	ISO	C16orf87 (Homo sapiens)	6480464	coumarin results in increased phosphorylation of C16ORF87 protein	CTD	PMID:35688186
4921524J17Rik	Mouse	cyclosporin A	increases expression	ISO	C16orf87 (Homo sapiens)	6480464	Cyclosporine results in increased expression of C16ORF87 mRNA	CTD	PMID:25562108
4921524J17Rik	Mouse	dicrotophos	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	dicrotophos results in decreased expression of C16ORF87 mRNA	CTD	PMID:28302478
4921524J17Rik	Mouse	dorsomorphin	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
4921524J17Rik	Mouse	FR900359	increases phosphorylation	ISO	C16orf87 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of C16ORF87 protein	CTD	PMID:37730182
4921524J17Rik	Mouse	fulvestrant	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of C16ORF87 gene	CTD	PMID:31601247
4921524J17Rik	Mouse	gentamycin	increases expression	ISO	C19h16orf87 (Rattus norvegicus)	6480464	Gentamicins results in increased expression of C19H16ORF87 mRNA	CTD	PMID:33387578
4921524J17Rik	Mouse	irinotecan	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	Irinotecan analog results in decreased expression of C16ORF87 mRNA	CTD	PMID:18927307
4921524J17Rik	Mouse	leflunomide	increases expression	ISO	C16orf87 (Homo sapiens)	6480464	leflunomide results in increased expression of C16ORF87 mRNA	CTD	PMID:28988120
4921524J17Rik	Mouse	manganese atom	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of C16ORF87 mRNA	CTD	PMID:39836092
4921524J17Rik	Mouse	manganese(0)	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of C16ORF87 mRNA	CTD	PMID:39836092
4921524J17Rik	Mouse	manganese(II) chloride	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of C16ORF87 mRNA	CTD	PMID:39836092
4921524J17Rik	Mouse	methamphetamine	increases expression	ISO	C19h16orf87 (Rattus norvegicus)	6480464	Methamphetamine results in increased expression of C19H16ORF87 mRNA	CTD	PMID:19564919
4921524J17Rik	Mouse	methylmercury chloride	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of C16ORF87 mRNA	CTD	PMID:28001369
4921524J17Rik	Mouse	panobinostat	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of C16ORF87 mRNA	CTD	PMID:27188386
4921524J17Rik	Mouse	phenylmercury acetate	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of C16ORF87 mRNA	CTD	PMID:26272509
4921524J17Rik	Mouse	phenylmercury acetate	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of C16ORF87 mRNA	CTD	PMID:27188386
4921524J17Rik	Mouse	quercetin	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	Quercetin results in decreased expression of C16ORF87 mRNA	CTD	PMID:21632981
4921524J17Rik	Mouse	rac-lactic acid	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of C16ORF87 mRNA	CTD	PMID:30851411
4921524J17Rik	Mouse	SB 431542	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
4921524J17Rik	Mouse	sodium arsenite	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of C16ORF87 mRNA	CTD	PMID:34032870
4921524J17Rik	Mouse	sodium arsenite	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of C16ORF87 mRNA	CTD	PMID:39836092
4921524J17Rik	Mouse	tetrachloromethane	increases expression	ISO	C19h16orf87 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in increased expression of C19H16ORF87 mRNA	CTD	PMID:31150632
4921524J17Rik	Mouse	tetrachloromethane	multiple interactions	ISO	C19h16orf87 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of C19H16ORF87 mRNA]	CTD	PMID:31150632
4921524J17Rik	Mouse	thioacetamide	increases expression	ISO	C19h16orf87 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of C19H16ORF87 mRNA	CTD	PMID:34492290
4921524J17Rik	Mouse	trichostatin A	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	trichostatin A results in decreased expression of C16ORF87 mRNA	CTD	PMID:24935251 and PMID:26272509
4921524J17Rik	Mouse	trichostatin A	affects expression	ISO	C16orf87 (Homo sapiens)	6480464	trichostatin A affects the expression of C16ORF87 mRNA	CTD	PMID:28542535
4921524J17Rik	Mouse	trichostatin A	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of C16ORF87 mRNA	CTD	PMID:27188386
4921524J17Rik	Mouse	valproic acid	increases expression	ISO	C16orf87 (Homo sapiens)	6480464	Valproic Acid results in increased expression of C16ORF87 mRNA	CTD	PMID:29154799
4921524J17Rik	Mouse	valproic acid	decreases expression	ISO	C16orf87 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of C16ORF87 mRNA	CTD	PMID:23179753 more ...
4921524J17Rik	Mouse	valproic acid	multiple interactions	ISO	C16orf87 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of C16ORF87 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4921524J17Rik	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4921524J17Rik	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4921524J17Rik	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015
4921524J17Rik	Mouse	protein binding	enables	ISO	UniProtKB:Q13547	9068941	PMID:23752268 more ...	IntAct	PMID:23752268 more ...
4921524J17Rik	Mouse	protein binding	enables	ISO	UniProtKB:P43365	9068941	PMID:25416956	IntAct	PMID:25416956
4921524J17Rik	Mouse	protein binding	enables	ISO	UniProtKB:P61981 more ...	9068941	PMID:32814053	IntAct	PMID:32814053
4921524J17Rik	Mouse	protein binding	enables	ISO	UniProtKB:A7MD48 and UniProtKB:P43365	9068941	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466305	PMID:12466851	PMID:12477932	PMID:12520002	PMID:12904583	PMID:14610273	PMID:15741177	PMID:16141072
PMID:16141073	PMID:17967808	PMID:18799693	PMID:20436479	PMID:21267068	PMID:26238476	PMID:34321999

4921524J17Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	86,135,388 - 86,159,470 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	86,135,388 - 86,159,462 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	85,408,759 - 85,432,841 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	85,408,759 - 85,432,833 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,932,658 - 87,956,740 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	88,298,864 - 88,322,938 (-)	NCBI		MGSCv36	mm8
Celera	8	89,703,821 - 89,727,627 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.61	NCBI

C16orf87
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	46,796,603 - 46,831,180 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	46,796,603 - 46,831,180 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	46,830,515 - 46,865,092 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	45,393,460 - 45,422,575 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	31,344,142 - 31,373,247 (-)	NCBI		Celera
Cytogenetic Map	16	q11.2	NCBI
HuRef	16	32,725,523 - 32,754,643 (-)	NCBI		HuRef
CHM1_1	16	48,243,141 - 48,272,248 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	52,593,496 - 52,628,075 (-)	NCBI		T2T-CHM13v2.0

C19h16orf87
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	37,800,187 - 37,827,091 (+)	NCBI		GRCr8
mRatBN7.2	19	21,626,390 - 21,653,869 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	21,626,914 - 21,654,255 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	23,317,500 - 23,344,470 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	28,512,016 - 28,538,984 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	31,474,835 - 31,501,808 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	22,699,808 - 22,726,712 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	22,699,808 - 22,726,701 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	33,717,644 - 33,744,539 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	22,984,411 - 23,011,305 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	22,989,047 - 23,016,229 (+)	NCBI
Celera	19	21,486,846 - 21,513,739 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

CUNH16orf87
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955448	333,903 - 366,598 (-)	NCBI	ChiLan1.0	ChiLan1.0

C18H16orf87
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	56,261,261 - 56,291,039 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	62,160,840 - 62,196,049 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	27,061,836 - 27,097,017 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

C15H16orf87
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	35,188,924 - 35,189,599 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	8,290,030 - 8,350,937 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	8,476,970 - 8,505,249 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	8,439,304 - 8,468,528 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	8,439,358 - 8,467,853 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	8,268,315 - 8,296,781 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	8,317,124 - 8,377,821 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	8,365,014 - 8,393,463 (+)	NCBI		UU_Cfam_GSD_1.0

CUNH16orf87
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	59,400,113 - 59,426,862 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	162,207 - 189,142 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	162,213 - 188,945 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C6H16orf87
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	37,784,694 - 37,817,195 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	37,784,499 - 37,817,907 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	33,099,704 - 33,107,199 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CUNH16orf87
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	32,651,752 - 32,683,595 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	32,651,744 - 32,683,381 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	43,916,792 - 43,948,764 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH16orf87
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624914	283,143 - 310,253 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in 4921524J17Rik
2070 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	222
Count of miRNA genes:	189
Interacting mature miRNAs:	203
Transcripts:	ENSMUST00000047749
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	66326836	100326976	Mouse
1301013	Capsq4_m	capsaicin sensitivity related QTL 4 (mouse)			Not determined		8	36630154	93455280	Mouse
12904012	Cfq10_m	conditioned fear QTL 10 (mouse)					8	80793404	89740987	Mouse
11353828	Gf7_m	gonadal fat pad weight 7 (mouse)					8	58928107	92928107	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	35109930	115563747	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	66084397	100084549	Mouse
1301506	Aevm1_m	autoimmune extremity vasculitis in MRL mice 1 (mouse)			Not determined		8	54740461	88740637	Mouse
1301952	Im3_m	immunoregulatory 3 (mouse)			Not determined		8	55159258	89159407	Mouse
1301767	Fcsa2_m	femoral cross-sectional area 2 (mouse)			Not determined		8	71032003	105032123	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	76411976	110412125	Mouse
1301766	Desp1_m	despair 1 (mouse)			Not determined		8	85486208	119486373	Mouse
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32506572	117965439	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			64186736	98186736	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	64666176	98666325	Mouse
10755519	Wbc1_m	white blood cell count 1 (mouse)					8	82345783	116345783	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37867154	110326632	Mouse
10043975	Obq31_m	obesity QTL 31 (mouse)			Not determined		8	59136404	93136404	Mouse
1301581	Char2_m	P. chabaudi malaria resistance QTL 2 (mouse)			Not determined		8	79808806	113809031	Mouse
10412287	Carg3_m	Candida albicans resistance gene 3 (mouse)			Not determined		8	56298872	90298872	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	72122809	106123021	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	61513479	95513605	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71829531	105829637	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73929123	107929226	Mouse
12904744	Carcdq1_m	cardiac collagen deposition QTL 1 (mouse)					8	40162297	95416226	Mouse
4141395	Char2a_m	P. chabaudi malaria resistance QTL 2a (mouse)			Not determined			71589427	90929226	Mouse
14700686	Civq3_m	cerebral infarct volume QTL 3 (mouse)					8	52334843	86334843	Mouse
10755530	Wbc2_m	white blood cell count 2 (mouse)					8	81819296	115819296	Mouse
4142283	Imraq2_m	immune response to AAV2 QTL 2 (mouse)			Not determined		8	71032003	105032123	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1301099	Cbm2_m	cerebellum weight 2 (mouse)			Not determined		8	79245241	113245331	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	76402145	110402251	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_025722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_033144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA030168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC130533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK007050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK013123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK014959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK017512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK169408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC027027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC040087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC050139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK333687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000047749 ⟹ ENSMUSP00000040975

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	86,135,388 - 86,159,462 (-)	Ensembl
GRCm38.p6 Ensembl	8	85,408,759 - 85,432,833 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000209355 ⟹ ENSMUSP00000147531

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	86,136,447 - 86,159,450 (-)	Ensembl
GRCm38.p6 Ensembl	8	85,409,818 - 85,432,821 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000210556

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	86,138,872 - 86,159,443 (-)	Ensembl
GRCm38.p6 Ensembl	8	85,412,243 - 85,432,814 (-)	Ensembl

RefSeq Acc Id:

NM_025722 ⟹ NP_079998

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	86,135,388 - 86,159,470 (-)	NCBI
GRCm38	8	85,408,759 - 85,432,841 (-)	ENTREZGENE
MGSCv37	8	87,932,658 - 87,956,740 (-)	RGD
Celera	8	89,703,821 - 89,727,627 (-)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

CGCAGCCCCGCGCACGCGCACGCGCGCCTCCACGGCTGGGTCGCGGCTGGAGTGAGGACGCGCTGTGTGGAGCAGCGGAGGCACGGCGCTGCTTCCACCGCTGCTCAGGAGGGGAGCATGTCTGCAAC
TCGAGCCAAGAAAGTGAAGATGGCCACCAAATCGTGCCCCGAGTGCGACCAACAGATTCCTGTTGCGTGTAAATCATGTCCCTGTGGTTACATATTTATTAGCAGAAAACTACTAAATGCAAAACATT
CAGAGAAATCACCGCCGTCTACAGAAAACAAGCACGAGGCCAAGAGGAGGCGAACAGAGAGAGTTAGGCGAGAGAAGATAAATTCTACAGTAAATAAAGATTTAGAAAACAGAAAGAGATCTCGAAGT
AACAGCCATTCAGATCATATCAGACGAGGGAGAGGACGACCTAAAAGTTCATCCGCCAAAAAACACGAGGAAGAGAGAGAAAAACAGGAAAAGGAAATCGACATCTATGCTAACCTCTCTGATGAGAA
GGCTTTCGTGTTTTCAGTTGCCTTGGCAGAAATAAATAGAAAAATTATCAATCAAAGACTTATTCTCTGATATTTGTCTTCAAACTCTGTTGGTTGCCACTTTCTTCAGGATTGCATCAGCAGATCCT
CAGGCAGTCGTGGACTCTGAGGAGCACCAGACTGTGTGAATGAGGGCCTTTGGTTGCTTTCTCTGTTTCCTAGTCTGCTGCCACGCTTTGGGAGCAAAGCTGTGCGTTAGACTTTGCTGGGATTTCCT
TGTTTACCAAGGATCATTATCAGTGTTTTGTGTTGGGATATTACTAAATGTATTTACAAAGACAAACAAACAAAATGACCAGAAAAGCCCCGGAACCTGGATGGGTCTTTCCCGATTGGAGGGACAGG
AGTACGGGTGGAACACACAGCTGGAGCAGCTGACGTGCTTGCTAGTTTTCAGGTTCGCACCAGAGATGCAGTGTCTTAAGTCCTGTCAGGAGAGTGACTTTTAAATGTATGTATTTCAGGCTTTCACC
ATTAACAGATTGCATATATACAATCCATTGACTTTTAATAAATTGGTAATTGATATTTTATTGAATGGAGAATTACGAATATAGATTATAAATTCTGTCTTTAATTGACCTTTTTCTTGGGCGCTATT
TTAATGATTTAAGTAGGAGTTATATTTTCAGAAACTTTCTAGACAGTTTGGAAATTTGGGTGCTATATGAAGAAAAGCATTTGAGGCTGTATCATATTTCAGATATAAACACCTTGTTTTCTTGAATG
TTTTATTTATTGGTTTTTAAAAAAAACTTTTCTGTTATCAAGATGGTGCCTGTTAACCTAAACACAGATATATTTATTATATAAATTGCAAAATATTTCTTAGCTACTTGTGAACAGTGATTTTTTTT
TGTCTGAATGTTCATTTATACATAATTCTGGTAATTATTTAAATTGTTACTTCATCCTGGAAAAAAATAAACCTTAATATTGAAAGCGAGTAGATTAAGTAGTGTGGTGTAGCTTTTTGTCCTAGTGA
AGTTTGTAAAGTGTTTCAGCCAGTTTTTGCAGTATTAAATCATCATTCCTTATACTCGC

hide sequence

RefSeq Acc Id:

NR_033144

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	86,135,388 - 86,159,470 (-)	NCBI
GRCm38	8	85,408,759 - 85,432,841 (-)	ENTREZGENE
MGSCv37	8	87,932,658 - 87,956,740 (-)	RGD
Celera	8	89,703,821 - 89,727,627 (-)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

CGCAGCCCCGCGCACGCGCACGCGCGCCTCCACGGCTGGGTCGCGGCTGGAGTGAGGACGCGCT
GTGTGGAGCAGCGGAGGCACGGCGCTGCTTCCACCGCTGCTCAGGAGGGGAGCATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCGTGCCCCGAGTGCGACCAACAGAAAACAAGC
ACGAGGCCAAGAGGAGGCGAACAGAGAGAGTTAGGCGAGAGAAGATAAATTCTACAGTAAATAAAGATTTAGAAAACAGAAAGAGATCTCGAAGTAACAGCCATTCAGATCATATCAGACGAGGGAGA
GGACGACCTAAAAGTTCATCCGCCAAAAAACACGAGGAAGAGAGAGAAAAACAGGAAAAGGAAATCGACATCTATGCTAACCTCTCTGATGAGAAGGCTTTCGTGTTTTCAGTTGCCTTGGCAGAAAT
AAATAGAAAAATTATCAATCAAAGACTTATTCTCTGATATTTGTCTTCAAACTCTGTTGGTTGCCACTTTCTTCAGGATTGCATCAGCAGATCCTCAGGCAGTCGTGGACTCTGAGGAGCACCAGACT
GTGTGAATGAGGGCCTTTGGTTGCTTTCTCTGTTTCCTAGTCTGCTGCCACGCTTTGGGAGCAAAGCTGTGCGTTAGACTTTGCTGGGATTTCCTTGTTTACCAAGGATCATTATCAGTGTTTTGTGT
TGGGATATTACTAAATGTATTTACAAAGACAAACAAACAAAATGACCAGAAAAGCCCCGGAACCTGGATGGGTCTTTCCCGATTGGAGGGACAGGAGTACGGGTGGAACACACAGCTGGAGCAGCTGA
CGTGCTTGCTAGTTTTCAGGTTCGCACCAGAGATGCAGTGTCTTAAGTCCTGTCAGGAGAGTGACTTTTAAATGTATGTATTTCAGGCTTTCACCATTAACAGATTGCATATATACAATCCATTGACT
TTTAATAAATTGGTAATTGATATTTTATTGAATGGAGAATTACGAATATAGATTATAAATTCTGTCTTTAATTGACCTTTTTCTTGGGCGCTATTTTAATGATTTAAGTAGGAGTTATATTTTCAGAA
ACTTTCTAGACAGTTTGGAAATTTGGGTGCTATATGAAGAAAAGCATTTGAGGCTGTATCATATTTCAGATATAAACACCTTGTTTTCTTGAATGTTTTATTTATTGGTTTTTAAAAAAAACTTTTCT
GTTATCAAGATGGTGCCTGTTAACCTAAACACAGATATATTTATTATATAAATTGCAAAATATTTCTTAGCTACTTGTGAACAGTGATTTTTTTTTGTCTGAATGTTCATTTATACATAATTCTGGTA
ATTATTTAAATTGTTACTTCATCCTGGAAAAAAATAAACCTTAATATTGAAAGCGAGTAGATTAAGTAGTGTGGTGTAGCTTTTTGTCCTAGTGAAGTTTGTAAAGTGTTTCAGCCAGTTTTTGCAGT
ATTAAATCATCATTCCTTATACTCGC

hide sequence


Protein RefSeqs	NP_079998	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH40087	(Get FASTA)	NCBI Sequence Viewer
	AAH50139	(Get FASTA)	NCBI Sequence Viewer
	BAB28662	(Get FASTA)	NCBI Sequence Viewer
	BAB29640	(Get FASTA)	NCBI Sequence Viewer
	BAB30783	(Get FASTA)	NCBI Sequence Viewer
	BAE41154	(Get FASTA)	NCBI Sequence Viewer
	EDL11012	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000040975
	ENSMUSP00000040975.6
GenBank Protein	Q9CR55	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_079998 ⟸ NM_025722
- UniProtKB:	Q9CR55 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSATRAKKVKMATKSCPECDQQIPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEAKRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSSSAKKHEEEREKQEKEIDIYANL SDEKAFVFSVALAEINRKIINQRLIL hide sequence

Ensembl Acc Id:

ENSMUSP00000040975 ⟸ ENSMUST00000047749

Ensembl Acc Id:

ENSMUSP00000147531 ⟸ ENSMUST00000209355

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CR55-F1-model_v2	AlphaFold	Q9CR55	1-154	view protein structure

RGD ID:

8667763

Promoter ID:

EPDNEW_M11913

Type:

initiation region

Name:

4921524J17Rik_1

Description:

Mus musculus RIKEN cDNA 4921524J17 gene , transcript variant2, non-coding RNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	85,432,810 - 85,432,870	EPDNEW

RGD ID:

6842519

Promoter ID:

MM_KWN:55151

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day1, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain

Transcripts:

NM_025722, NM_025722_4921524J17RIK, NR_033144

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	8	87,956,454 - 87,956,954 (-)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000036934	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000047749	ENTREZGENE
	ENSMUST00000047749.7	UniProtKB/Swiss-Prot
InterPro	C16orf87-like	UniProtKB/Swiss-Prot
	UPF0547	UniProtKB/Swiss-Prot
KEGG Report	mmu:66714	UniProtKB/Swiss-Prot
MGD	MGI:1913964	ENTREZGENE
NCBI Gene	66714	ENTREZGENE
PANTHER	PTHR31101	UniProtKB/Swiss-Prot
Pfam	UPF0547	UniProtKB/Swiss-Prot
PhenoGen	4921524J17Rik	PhenoGen
UniProt	A0A1B0GRH9_MOUSE	UniProtKB/TrEMBL
	CP087_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9CZ14_MOUSE	UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar