Symbol:
Krtcap2
Name:
keratinocyte associated protein 2
RGD ID:
1318166
MGI Page
MGI
Description:
Predicted to enable enzyme activator activity. Predicted to be involved in protein N-linked glycosylation. Part of oligosaccharyltransferase complex. Is expressed in several structures, including central nervous system and eye. Orthologous to human KRTCAP2 (keratinocyte associated protein 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
0610010I12Rik; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; KCP-2; Kcp2; keratinocyte-associated protein 2; keratinocytes associated protein 2; oligosaccharyl transferase subunit KCP2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KRTCAP2 (keratinocyte associated protein 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Krtcap2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Krtcap2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KRTCAP2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KRTCAP2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Krtcap2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KRTCAP2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KRTCAP2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Krtcap2 (keratinocyte associated protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Krtcap2 (keratinocyte associated protein 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KRTCAP2 (keratinocyte associated protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
krtcap2 (keratinocyte associated protein 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG31460
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 89,153,201 - 89,157,036 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 89,153,273 - 89,157,213 (+) Ensembl GRCm39 Ensembl GRCm38 3 89,245,904 - 89,249,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 89,245,966 - 89,249,906 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 89,050,360 - 89,053,644 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 89,332,365 - 89,335,649 (+) NCBI MGSCv36 mm8 Celera 3 89,280,385 - 89,283,673 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.03 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Krtcap2 Mouse (+)-catechin multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of KRTCAP2 mRNA CTD PMID:24763279 Krtcap2 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KRTCAP2 mRNA CTD PMID:36331819 Krtcap2 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRTCAP2 mRNA CTD PMID:22206623 Krtcap2 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KRTCAP2 mRNA CTD PMID:22206623 Krtcap2 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRTCAP2 mRNA CTD PMID:17942748 Krtcap2 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of KRTCAP2 mRNA CTD PMID:17942748 Krtcap2 Mouse 17beta-estradiol multiple interactions ISO Krtcap2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of KRTCAP2 mRNA CTD PMID:26496021 Krtcap2 Mouse 17beta-estradiol increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Estradiol results in increased expression of KRTCAP2 mRNA CTD PMID:32145629 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO KRTCAP2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRTCAP2 mRNA CTD PMID:19684285 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRTCAP2 mRNA CTD PMID:33387578 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRTCAP2 mRNA CTD PMID:34747641 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KRTCAP2 mRNA CTD PMID:21570461 and PMID:24680724 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KRTCAP2 mRNA CTD PMID:15328365 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRTCAP2 mRNA CTD PMID:17942748 Krtcap2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of KRTCAP2 mRNA CTD PMID:19684285 Krtcap2 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of KRTCAP2 mRNA CTD PMID:28628672 Krtcap2 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of KRTCAP2 mRNA CTD PMID:28628672 Krtcap2 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of KRTCAP2 mRNA CTD PMID:39298647 Krtcap2 Mouse 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of KRTCAP2 mRNA CTD PMID:30951980 Krtcap2 Mouse 6-propyl-2-thiouracil increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of KRTCAP2 mRNA CTD PMID:30047161 Krtcap2 Mouse acrylamide affects expression ISO Krtcap2 (Rattus norvegicus) 6480464 Acrylamide affects the expression of KRTCAP2 mRNA CTD PMID:28959563 Krtcap2 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of KRTCAP2 mRNA more ... CTD PMID:30951980 Krtcap2 Mouse amitrole increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Amitrole results in increased expression of KRTCAP2 mRNA CTD PMID:30047161 Krtcap2 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of KRTCAP2 mRNA CTD PMID:33754040 Krtcap2 Mouse bisphenol A multiple interactions ISO Krtcap2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of KRTCAP2 mRNA and [bisphenol A co-treated with Testosterone] results in increased expression of KRTCAP2 mRNA CTD PMID:26496021 Krtcap2 Mouse bisphenol A affects expression ISO KRTCAP2 (Homo sapiens) 6480464 bisphenol A affects the expression of KRTCAP2 mRNA CTD PMID:30903817 Krtcap2 Mouse bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of KRTCAP2 mRNA CTD PMID:30951980 Krtcap2 Mouse bisphenol A increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of KRTCAP2 mRNA CTD PMID:25181051 and PMID:32145629 Krtcap2 Mouse bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of KRTCAP2 mRNA CTD PMID:30951980 Krtcap2 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of KRTCAP2 mRNA CTD PMID:38685157 Krtcap2 Mouse butan-1-ol multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of KRTCAP2 mRNA CTD PMID:29432896 Krtcap2 Mouse cadmium dichloride decreases expression ISO KRTCAP2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of KRTCAP2 mRNA CTD PMID:38568856 Krtcap2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of KRTCAP2 mRNA CTD PMID:25554681 and PMID:25620056 Krtcap2 Mouse CGP 52608 multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KRTCAP2 gene] CTD PMID:28238834 Krtcap2 Mouse chloropicrin increases expression ISO KRTCAP2 (Homo sapiens) 6480464 chloropicrin results in increased expression of KRTCAP2 mRNA CTD PMID:26352163 Krtcap2 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of KRTCAP2 mRNA CTD PMID:37019170 Krtcap2 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of KRTCAP2 gene CTD PMID:20938992 Krtcap2 Mouse chrysene decreases expression EXP 6480464 chrysene results in decreased expression of KRTCAP2 mRNA CTD PMID:26377693 Krtcap2 Mouse cisplatin decreases expression ISO KRTCAP2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of KRTCAP2 mRNA CTD PMID:27594783 Krtcap2 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of KRTCAP2 mRNA CTD PMID:27462272 Krtcap2 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of KRTCAP2 mRNA CTD PMID:17585979 Krtcap2 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KRTCAP2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KRTCAP2 mRNA] CTD PMID:17585979 Krtcap2 Mouse clofibric acid multiple interactions ISO Krtcap2 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of KRTCAP2 mRNA CTD PMID:17602206 Krtcap2 Mouse cycloheximide multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of KRTCAP2 mRNA CTD PMID:19684285 Krtcap2 Mouse cyclosporin A increases expression ISO KRTCAP2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of KRTCAP2 mRNA CTD PMID:20106945 more ... Krtcap2 Mouse dexamethasone multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of KRTCAP2 mRNA CTD PMID:28628672 Krtcap2 Mouse Dibutyl phosphate affects expression ISO KRTCAP2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KRTCAP2 mRNA CTD PMID:37042841 Krtcap2 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of KRTCAP2 mRNA CTD PMID:21266533 Krtcap2 Mouse dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of KRTCAP2 mRNA CTD PMID:32052077 Krtcap2 Mouse diuron decreases expression ISO KRTCAP2 (Homo sapiens) 6480464 Diuron results in decreased expression of KRTCAP2 mRNA CTD PMID:35967413 Krtcap2 Mouse endosulfan affects expression ISO Krtcap2 (Rattus norvegicus) 6480464 Endosulfan affects the expression of KRTCAP2 mRNA CTD PMID:29391264 Krtcap2 Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Krtcap2 Mouse FR900359 decreases phosphorylation ISO KRTCAP2 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of KRTCAP2 protein CTD PMID:37730182 Krtcap2 Mouse gentamycin increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of KRTCAP2 mRNA CTD PMID:22061828 Krtcap2 Mouse glafenine increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Glafenine results in increased expression of KRTCAP2 mRNA CTD PMID:24136188 Krtcap2 Mouse indometacin multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of KRTCAP2 mRNA CTD PMID:28628672 Krtcap2 Mouse isobutanol multiple interactions ISO KRTCAP2 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of KRTCAP2 mRNA CTD PMID:29432896 Krtcap2 Mouse ivermectin decreases expression ISO KRTCAP2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of KRTCAP2 protein CTD PMID:32959892 Krtcap2 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of KRTCAP2 gene CTD PMID:20938992 Krtcap2 Mouse methimazole increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Methimazole results in increased expression of KRTCAP2 mRNA CTD PMID:30047161 Krtcap2 Mouse N-nitrosodiethylamine multiple interactions ISO Krtcap2 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of KRTCAP2 mRNA CTD PMID:17602206 Krtcap2 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KRTCAP2 mRNA CTD PMID:35964746 Krtcap2 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KRTCAP2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KRTCAP2 mRNA] CTD PMID:17585979 Krtcap2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KRTCAP2 mRNA CTD PMID:36331819 Krtcap2 Mouse phenobarbital increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Phenobarbital results in increased expression of KRTCAP2 mRNA CTD PMID:30047161 Krtcap2 Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of KRTCAP2 mRNA CTD PMID:21278054 Krtcap2 Mouse sulfadimethoxine increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of KRTCAP2 mRNA CTD PMID:30047161 Krtcap2 Mouse sunitinib increases expression ISO KRTCAP2 (Homo sapiens) 6480464 Sunitinib results in increased expression of KRTCAP2 mRNA CTD PMID:31533062 Krtcap2 Mouse testosterone multiple interactions ISO Krtcap2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of KRTCAP2 mRNA CTD PMID:26496021 Krtcap2 Mouse testosterone decreases expression EXP 6480464 Testosterone deficiency results in decreased expression of KRTCAP2 mRNA CTD PMID:33848595 Krtcap2 Mouse tetrachloroethene decreases expression EXP 6480464 Tetrachloroethylene results in decreased expression of KRTCAP2 mRNA CTD PMID:28973375 Krtcap2 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of KRTCAP2 mRNA CTD PMID:31919559 Krtcap2 Mouse thapsigargin increases expression ISO KRTCAP2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of KRTCAP2 mRNA CTD PMID:22378314 and PMID:29453283 Krtcap2 Mouse thioacetamide decreases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of KRTCAP2 mRNA CTD PMID:34492290 Krtcap2 Mouse thiram decreases expression ISO KRTCAP2 (Homo sapiens) 6480464 Thiram results in decreased expression of KRTCAP2 mRNA CTD PMID:38568856 Krtcap2 Mouse trichloroethene increases expression ISO Krtcap2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of KRTCAP2 mRNA CTD PMID:33387578 Krtcap2 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of KRTCAP2 mRNA CTD PMID:33045310 Krtcap2 Mouse tunicamycin increases expression ISO KRTCAP2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of KRTCAP2 mRNA CTD PMID:22378314 and PMID:29453283 Krtcap2 Mouse valproic acid increases methylation ISO KRTCAP2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KRTCAP2 gene CTD PMID:29154799 Krtcap2 Mouse valproic acid increases expression ISO KRTCAP2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KRTCAP2 mRNA CTD PMID:23179753 and PMID:27188386 Krtcap2 Mouse vinclozolin decreases expression ISO Krtcap2 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of KRTCAP2 mRNA CTD PMID:23034163
Krtcap2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 89,153,201 - 89,157,036 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 89,153,273 - 89,157,213 (+) Ensembl GRCm39 Ensembl GRCm38 3 89,245,904 - 89,249,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 89,245,966 - 89,249,906 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 89,050,360 - 89,053,644 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 89,332,365 - 89,335,649 (+) NCBI MGSCv36 mm8 Celera 3 89,280,385 - 89,283,673 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.03 NCBI
KRTCAP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 155,169,408 - 155,173,304 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 155,169,408 - 155,173,475 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 155,141,884 - 155,145,780 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 153,408,508 - 153,412,428 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 151,954,957 - 151,958,877 NCBI Celera 1 128,213,149 - 128,217,068 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI HuRef 1 126,504,277 - 126,508,196 (-) NCBI HuRef CHM1_1 1 156,537,739 - 156,541,659 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 154,309,025 - 154,312,920 (-) NCBI T2T-CHM13v2.0
Krtcap2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 176,952,167 - 176,956,163 (+) NCBI GRCr8 mRatBN7.2 2 174,654,409 - 174,658,405 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,654,219 - 174,658,405 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,800,264 - 181,804,271 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,822,637 - 179,826,644 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,422,411 - 174,426,413 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,561,548 - 188,565,544 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,561,429 - 188,565,544 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 207,975,076 - 207,979,072 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,417,284 - 181,421,280 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,367,570 - 181,371,175 (+) NCBI Celera 2 168,596,758 - 168,600,754 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
Krtcap2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 1,642,578 - 1,645,698 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 1,642,578 - 1,645,699 (-) NCBI ChiLan1.0 ChiLan1.0
KRTCAP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 94,662,400 - 94,671,946 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 94,393,855 - 94,403,403 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 130,517,075 - 130,526,621 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 134,125,272 - 134,129,527 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 134,125,272 - 134,129,527 (-) Ensembl panpan1.1 panPan2
KRTCAP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 42,354,793 - 42,357,596 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 42,354,040 - 42,357,600 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 41,845,814 - 41,848,172 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 42,223,998 - 42,226,810 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 42,224,410 - 42,226,805 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 42,004,260 - 42,006,618 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 42,058,122 - 42,060,477 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 42,341,745 - 42,344,103 (+) NCBI UU_Cfam_GSD_1.0
Krtcap2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 25,645,230 - 25,647,932 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 4,675,606 - 4,678,249 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 4,675,612 - 4,678,264 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRTCAP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 94,642,942 - 94,646,436 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 94,643,300 - 94,646,436 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 103,425,947 - 103,429,083 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRTCAP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 8,659,239 - 8,666,375 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 8,658,881 - 8,666,831 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 7,986,770 - 7,991,395 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Krtcap2
.
Predicted Target Of
Count of predictions: 499 Count of miRNA genes: 198 Interacting mature miRNAs: 225 Transcripts: ENSMUST00000040888, ENSMUST00000126691, ENSMUST00000132818, ENSMUST00000168900 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 1301971 Cia5_m collagen induced arthritis QTL 5 (mouse) Not determined 3 66046658 100046795 Mouse 1301392 Eae3_m susceptibility to experimental allergic encephalomyelitis 3 (mouse) Not determined 3 79548730 113548837 Mouse 1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 1301791 Char4_m P. chabaudi malaria resistance QTL 4 (mouse) Not determined 3 69625509 100655290 Mouse 11049572 Lmr11c_m leishmaniasis resistance 11c (mouse) 3 72139967 106140094 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 4141294 Bmd24_m bone mineral density 24 (mouse) Not determined 3 61740061 95740241 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1300595 Tmevd2_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse) Not determined 3 75463302 109463549 Mouse 11251721 Ewc3_m ethanol withdrawal and consumption 3 (mouse) 3 69568554 103568554 Mouse 1300982 Lmr11_m leishmaniasis resistance 11 (mouse) Not determined 3 72139967 106140094 Mouse 12880419 V125Dq4_m vitamin D active form serum level QTL 4 (mouse) 3 58907307 92907307 Mouse 1301947 Pcfm3_m periosteal circumference and femur length 3 (mouse) Not determined 3 81084652 115084797 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 1301422 Sle11_m systematic lupus erythematosus susceptibility 11 (mouse) Not determined 3 70208904 104209042 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse
UniSTS:224858
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 89,246,301 - 89,246,478 UniSTS GRCm38 MGSCv37 3 89,050,223 - 89,050,400 UniSTS GRCm37 Celera 3 89,280,248 - 89,280,425 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 3 F2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000040888 ⟹ ENSMUSP00000043540
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 89,153,273 - 89,157,213 (+) Ensembl GRCm38.p6 Ensembl 3 89,245,966 - 89,249,906 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000126691
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 89,153,273 - 89,154,500 (+) Ensembl GRCm38.p6 Ensembl 3 89,245,966 - 89,247,193 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132818
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 89,156,174 - 89,157,029 (+) Ensembl GRCm38.p6 Ensembl 3 89,248,867 - 89,249,722 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000168900 ⟹ ENSMUSP00000130372
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 89,153,741 - 89,157,016 (+) Ensembl GRCm38.p6 Ensembl 3 89,246,434 - 89,249,709 (+) Ensembl
RefSeq Acc Id:
NM_001310625 ⟹ NP_001297554
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 89,153,780 - 89,157,036 (+) NCBI GRCm38 3 89,246,473 - 89,249,729 (+) NCBI
Sequence:
TTTCTCCAGGGACACGGATTGGACCACGGACGGGGCGTGATGGGTAACCGCACCGGCGGGATGCCCGGGCTGCTCTAGCGGGAGTGGGCGTTGGGGTGGTCCTCTTTTCTCCGTAGCCTCGTAGTCGG
hide sequence
RefSeq Acc Id:
NM_025327 ⟹ NP_079603
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 89,153,745 - 89,157,036 (+) NCBI GRCm38 3 89,246,438 - 89,249,729 (+) NCBI MGSCv37 3 89,050,360 - 89,053,644 (+) RGD Celera 3 89,280,385 - 89,283,673 (+) RGD cM Map 3 ENTREZGENE
Sequence:
GCGTACAGACAACCGCGCCGGCTTTGGCTCCCCTCTTTCTCCAGGGACACGGATTGGACCACGGACGGGGCGTGATGGTAGTCGGTACCGGGACCTCCTTGGCGCTGTCCTCCCTCCTGTCCCTGCTG
hide sequence
RefSeq Acc Id:
XM_006501870 ⟹ XP_006501933
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 89,153,220 - 89,157,030 (+) NCBI GRCm38 3 89,245,918 - 89,249,723 (+) NCBI
Sequence:
AGCTTCGAACTGCGTCCGTCGAGGTAGGGGGTGGGAAATAGTTCTTCCCACGTGGTTCTCCAAA
hide sequence
RefSeq Acc Id:
XM_030252748 ⟹ XP_030108608
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 89,153,201 - 89,157,030 (+) NCBI GRCm38 3 89,245,904 - 89,249,723 (+) NCBI
Sequence:
TGCGCATGCTCCAGGGACTAGCTTCGAACTGCGTCCGTCGAGAGGGCGCTGCACCCAAGGCGCGTAGAGGAAGAAGTAAAGCAAGTCCACGTTGGCCCCGACGCCTGCGTACAGACAACCGCGCCGGC
hide sequence
RefSeq Acc Id:
XM_030252749 ⟹ XP_030108609
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 89,153,750 - 89,157,030 (+) NCBI GRCm38 3 89,246,470 - 89,249,723 (+) NCBI
Sequence:
CAGACAACCGCGCCGGCTTTGGCTCCCCTCTTTCTCCAGGGACACGGATTGGACCACGGACGGGGCGTGATGGGTAACCGCACCGGCGGGATGCCCGGGCTGCTCTAGCGGGAGTGGGCGTTGGGGTG
hide sequence
RefSeq Acc Id:
NP_079603 ⟸ NM_025327
- Peptide Label:
isoform 1
- UniProtKB:
Q9CQK5 (UniProtKB/Swiss-Prot), Q5RL79 (UniProtKB/Swiss-Prot)
- Sequence:
MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKI
hide sequence
RefSeq Acc Id:
XP_006501933 ⟸ XM_006501870
- Peptide Label:
isoform X1
- Sequence:
MSAACPERQQMPWLQKAGDQAGRWPRMLLEALFPPCHKRALHPRRVEEEVKQVHVGPDACVQTT
hide sequence
RefSeq Acc Id:
NP_001297554 ⟸ NM_001310625
- Peptide Label:
isoform 2
- UniProtKB:
A0A0A0MQN1 (UniProtKB/TrEMBL)
- Sequence:
MQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFAS
hide sequence
RefSeq Acc Id:
XP_030108608 ⟸ XM_030252748
- Peptide Label:
isoform X2
- UniProtKB:
Q5RL79 (UniProtKB/Swiss-Prot), Q9CQK5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030108609 ⟸ XM_030252749
- Peptide Label:
isoform X3
- UniProtKB:
A0A0A0MQN1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000043540 ⟸ ENSMUST00000040888
Ensembl Acc Id:
ENSMUSP00000130372 ⟸ ENSMUST00000168900
RGD ID: 6833999 Promoter ID: MM_KWN:34936 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, Brain, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000052240, OTTMUST00000052242 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 89,050,074 - 89,050,574 (+) MPROMDB
RGD ID: 6833998 Promoter ID: MM_KWN:34937 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, MEF_B6 Transcripts: OTTMUST00000052241 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 89,052,201 - 89,053,012 (+) MPROMDB
RGD ID: 6881224 Promoter ID: EPDNEW_M4063 Type: initiation region Name: Krtcap2_1 Description: Mus musculus keratinocyte associated protein 2 , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 89,246,470 - 89,246,530 EPDNEW
