Symbol:
Tmem119
Name:
transmembrane protein 119
RGD ID:
1316846
MGI Page
MGI
Description:
Involved in several processes, including BMP signaling pathway; endochondral ossification; and negative regulation of bone resorption. Acts upstream of or within osteoblast differentiation. Located in endoplasmic reticulum and plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; limb; and skeleton. Orthologous to human TMEM119 (transmembrane protein 119).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AW208946; BC025600; MGC38046; ob; obif; osteoblast induction factor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TMEM119 (transmembrane protein 119) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tmem119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tmem119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TMEM119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TMEM119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tmem119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TMEM119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TMEM119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tmem119 (transmembrane protein 119) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tmem119 (transmembrane protein 119)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TMEM119 (transmembrane protein 119)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tmem119b (transmembrane protein 119b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
tmem119a (transmembrane protein 119a)
Alliance
DIOPT (PANTHER|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 113,931,790 - 113,938,457 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 113,931,790 - 113,938,577 (-) Ensembl GRCm39 Ensembl GRCm38 5 113,793,729 - 113,800,396 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 113,793,729 - 113,800,516 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 114,243,738 - 114,250,367 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 114,054,728 - 114,061,357 (-) NCBI MGSCv36 mm8 Celera 5 110,894,838 - 110,901,705 (-) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.55 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmem119 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of TMEM119 mRNA] CTD PMID:22206623 Tmem119 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of TMEM119 mRNA CTD PMID:22206623 Tmem119 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TMEM119 mRNA CTD PMID:19484750 Tmem119 Mouse 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in decreased expression of more ... CTD PMID:38995820 Tmem119 Mouse 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO RGD:1602276 6480464 2,5,2',5'-tetrachlorobiphenyl analog results in decreased expression of TMEM119 mRNA CTD PMID:36804509 Tmem119 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEM119 mRNA CTD PMID:19933214 Tmem119 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1602276 6480464 Tetrachlorodibenzodioxin affects the expression of TMEM119 mRNA CTD PMID:36370075 Tmem119 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TMEM119 mRNA CTD PMID:26377647 Tmem119 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of TMEM119 mRNA CTD PMID:38648751 Tmem119 Mouse 2-methylcholine affects expression ISO RGD:1602276 6480464 beta-methylcholine affects the expression of TMEM119 mRNA CTD PMID:21179406 Tmem119 Mouse 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of TMEM119 mRNA CTD PMID:20713471 Tmem119 Mouse 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of TMEM119 mRNA CTD PMID:30951980 Tmem119 Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:1602276 6480464 bisphenol S results in increased expression of TMEM119 protein CTD PMID:34186270 Tmem119 Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of TMEM119 exon CTD PMID:33297965 Tmem119 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of TMEM119 mRNA CTD PMID:30951980 Tmem119 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of TMEM119 mRNA CTD PMID:28973697 Tmem119 Mouse aflatoxin B1 increases methylation ISO RGD:1602276 6480464 Aflatoxin B1 results in increased methylation of TMEM119 intron CTD PMID:30157460 Tmem119 Mouse all-trans-retinoic acid increases expression ISO RGD:1307573 6480464 Tretinoin results in increased expression of TMEM119 mRNA CTD PMID:20488242 Tmem119 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TMEM119 mRNA; [bisphenol S co-treated more ... CTD PMID:30951980 Tmem119 Mouse arsenite(3-) multiple interactions ISO RGD:1602276 6480464 arsenite promotes the reaction [G3BP1 protein binds to TMEM119 mRNA] CTD PMID:32406909 Tmem119 Mouse arsenous acid decreases expression ISO RGD:1602276 6480464 Arsenic Trioxide results in decreased expression of TMEM119 mRNA CTD PMID:26705709 Tmem119 Mouse benzo[a]pyrene increases expression ISO RGD:1602276 6480464 Benzo(a)pyrene results in increased expression of TMEM119 mRNA CTD PMID:20064835 Tmem119 Mouse benzo[a]pyrene affects methylation ISO RGD:1602276 6480464 Benzo(a)pyrene affects the methylation of TMEM119 promoter CTD PMID:27901495 Tmem119 Mouse benzo[a]pyrene diol epoxide I increases expression ISO RGD:1602276 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of TMEM119 mRNA CTD PMID:20382639 Tmem119 Mouse benzo[e]pyrene increases methylation ISO RGD:1602276 6480464 benzo(e)pyrene results in increased methylation of TMEM119 exon CTD PMID:30157460 Tmem119 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1307573 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of TMEM119 more ... CTD PMID:23359474 Tmem119 Mouse bisphenol A multiple interactions ISO RGD:1307573 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of TMEM119 more ... CTD PMID:23359474 Tmem119 Mouse bisphenol A increases expression ISO RGD:1602276 6480464 bisphenol A results in increased expression of TMEM119 mRNA CTD PMID:29275510 Tmem119 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TMEM119 mRNA CTD PMID:30951980|PMID:32156529 Tmem119 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TMEM119 mRNA CTD PMID:25594700|PMID:35598803 Tmem119 Mouse bisphenol A decreases expression ISO RGD:1307573 6480464 bisphenol A results in decreased expression of TMEM119 mRNA CTD PMID:25181051|PMID:30816183 Tmem119 Mouse bisphenol AF increases expression ISO RGD:1602276 6480464 bisphenol AF results in increased expression of TMEM119 protein CTD PMID:34186270 Tmem119 Mouse Bisphenol B increases expression ISO RGD:1602276 6480464 bisphenol B results in increased expression of TMEM119 protein CTD PMID:34186270 Tmem119 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of TMEM119 mRNA CTD PMID:30951980 Tmem119 Mouse bisphenol F increases expression ISO RGD:1602276 6480464 bisphenol F results in increased expression of TMEM119 protein CTD PMID:34186270 Tmem119 Mouse bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TMEM119 mRNA CTD PMID:30951980 Tmem119 Mouse butanal increases expression ISO RGD:1602276 6480464 butyraldehyde results in increased expression of TMEM119 mRNA CTD PMID:26079696 Tmem119 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of TMEM119 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Tmem119 Mouse chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of TMEM119 mRNA CTD PMID:23125180 Tmem119 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of TMEM119 mRNA CTD PMID:37019170 Tmem119 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Tmem119 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of TMEM119 mRNA CTD PMID:28472532 Tmem119 Mouse Cuprizon increases expression ISO RGD:1307573 6480464 Cuprizone results in increased expression of TMEM119 mRNA CTD PMID:27523638 Tmem119 Mouse cyclosporin A decreases methylation ISO RGD:1602276 6480464 Cyclosporine results in decreased methylation of TMEM119 promoter CTD PMID:27989131 Tmem119 Mouse diarsenic trioxide decreases expression ISO RGD:1602276 6480464 Arsenic Trioxide results in decreased expression of TMEM119 mRNA CTD PMID:26705709 Tmem119 Mouse dibutyl phthalate decreases expression ISO RGD:1307573 6480464 Dibutyl Phthalate results in decreased expression of TMEM119 mRNA CTD PMID:21266533 Tmem119 Mouse dibutyl phthalate multiple interactions ISO RGD:1307573 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of TMEM119 more ... CTD PMID:23359474 Tmem119 Mouse diethylstilbestrol decreases expression ISO RGD:1307573 6480464 Diethylstilbestrol results in decreased expression of TMEM119 mRNA CTD PMID:36653537 Tmem119 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TMEM119 mRNA CTD PMID:30529165 Tmem119 Mouse doxorubicin decreases expression ISO RGD:1602276 6480464 Doxorubicin results in decreased expression of TMEM119 mRNA CTD PMID:29803840 Tmem119 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of TMEM119 mRNA CTD PMID:35436446 Tmem119 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of TMEM119 mRNA CTD PMID:30319688 Tmem119 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992|PMID:22206623 Tmem119 Mouse furan increases expression ISO RGD:1307573 6480464 furan results in increased expression of TMEM119 mRNA CTD PMID:27387713 Tmem119 Mouse gentamycin affects expression ISO RGD:1307573 6480464 Gentamicins affects the expression of TMEM119 mRNA CTD PMID:33387578 Tmem119 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Tmem119 Mouse lidocaine increases expression ISO RGD:1307573 6480464 Lidocaine results in increased expression of TMEM119 mRNA CTD PMID:35283115 Tmem119 Mouse methapyrilene increases methylation ISO RGD:1602276 6480464 Methapyrilene results in increased methylation of TMEM119 exon CTD PMID:30157460 Tmem119 Mouse oxaliplatin multiple interactions ISO RGD:1307573 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TMEM119 mRNA CTD PMID:25729387 Tmem119 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Tmem119 Mouse ozone multiple interactions ISO RGD:1602276 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TMEM119 mRNA CTD PMID:35430440 Tmem119 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of TMEM119 mRNA CTD PMID:17562736 Tmem119 Mouse paracetamol decreases expression ISO RGD:1307573 6480464 Acetaminophen results in decreased expression of TMEM119 mRNA CTD PMID:33387578 Tmem119 Mouse perfluorohexanesulfonic acid increases expression EXP 6480464 perfluorohexanesulfonic acid results in increased expression of TMEM119 mRNA CTD PMID:37995155 Tmem119 Mouse Soman decreases expression ISO RGD:1307573 6480464 Soman results in decreased expression of TMEM119 mRNA CTD PMID:19281266 Tmem119 Mouse temozolomide decreases expression ISO RGD:1602276 6480464 Temozolomide results in decreased expression of TMEM119 mRNA CTD PMID:31758290 Tmem119 Mouse testosterone decreases expression ISO RGD:1602276 6480464 Testosterone results in decreased expression of TMEM119 mRNA CTD PMID:33359661 Tmem119 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TMEM119 mRNA CTD PMID:17484886 Tmem119 Mouse Theaflavin 3,3'-digallate affects expression ISO RGD:1602276 6480464 theaflavin-3,3'-digallate affects the expression of TMEM119 mRNA CTD PMID:34925699 Tmem119 Mouse topotecan multiple interactions ISO RGD:1307573 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TMEM119 mRNA CTD PMID:25729387 Tmem119 Mouse triclosan increases expression ISO RGD:1602276 6480464 Triclosan results in increased expression of TMEM119 mRNA CTD PMID:30510588 Tmem119 Mouse tunicamycin decreases expression ISO RGD:1602276 6480464 Tunicamycin results in decreased expression of TMEM119 mRNA CTD PMID:22378314 Tmem119 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of TMEM119 mRNA CTD PMID:17963808 Tmem119 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of TMEM119 mRNA CTD PMID:24896083 Tmem119 Mouse valproic acid affects expression ISO RGD:1602276 6480464 Valproic Acid affects the expression of TMEM119 mRNA CTD PMID:25979313 Tmem119 Mouse zaragozic acid A decreases expression ISO RGD:1307573 6480464 squalestatin 1 results in decreased expression of TMEM119 mRNA CTD PMID:27225895 Tmem119 Mouse zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of TMEM119 mRNA CTD PMID:27225895
1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-methylcholine (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) butanal (ISO) carbon nanotube (EXP) chloroprene (EXP) chlorpyrifos (EXP) choline (EXP) chromium(6+) (EXP) Cuprizon (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diethylstilbestrol (ISO) dioxygen (EXP) doxorubicin (ISO) epoxiconazole (EXP) ethanol (EXP) folic acid (EXP) furan (ISO) gentamycin (ISO) L-methionine (EXP) lidocaine (ISO) methapyrilene (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (EXP) Soman (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP) Theaflavin 3,3'-digallate (ISO) topotecan (ISO) triclosan (ISO) tunicamycin (ISO) valproic acid (EXP,ISO) zaragozic acid A (EXP,ISO)
Tmem119 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 113,931,790 - 113,938,457 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 113,931,790 - 113,938,577 (-) Ensembl GRCm39 Ensembl GRCm38 5 113,793,729 - 113,800,396 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 113,793,729 - 113,800,516 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 114,243,738 - 114,250,367 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 114,054,728 - 114,061,357 (-) NCBI MGSCv36 mm8 Celera 5 110,894,838 - 110,901,705 (-) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.55 NCBI
TMEM119 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 108,589,851 - 108,598,084 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 108,589,851 - 108,598,320 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 108,983,627 - 108,991,860 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 107,507,756 - 107,515,913 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 108,653,016 - 108,661,288 (-) NCBI Celera Cytogenetic Map 12 q23.3 NCBI HuRef 12 106,047,977 - 106,056,250 (-) NCBI HuRef CHM1_1 12 108,950,373 - 108,958,645 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 108,564,436 - 108,572,683 (-) NCBI T2T-CHM13v2.0
Tmem119 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 48,489,157 - 48,496,214 (+) NCBI GRCr8 mRatBN7.2 12 42,828,621 - 42,835,678 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 42,828,418 - 42,835,689 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 43,994,907 - 44,001,984 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 44,608,504 - 44,615,581 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 43,669,038 - 43,676,115 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 48,598,498 - 48,605,704 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 48,598,647 - 48,605,704 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 50,380,454 - 50,387,588 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 43,863,011 - 43,870,068 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 43,731,406 - 43,732,498 (+) NCBI Celera 12 44,430,205 - 44,437,274 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
Tmem119 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 9,856,443 - 9,863,100 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 9,856,443 - 9,863,100 (-) NCBI ChiLan1.0 ChiLan1.0
TMEM119 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 116,654,849 - 116,663,227 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 116,651,254 - 116,659,541 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 106,166,737 - 106,173,965 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 109,561,987 - 109,570,389 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 109,563,684 - 109,564,535 (-) Ensembl panpan1.1 panPan2
TMEM119 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 18,275,719 - 18,282,905 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 18,260,923 - 18,282,409 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 17,519,003 - 17,526,176 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 18,619,952 - 18,627,106 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 18,605,512 - 18,626,613 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 17,728,101 - 17,735,247 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 18,610,928 - 18,618,116 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 18,629,671 - 18,636,823 (+) NCBI UU_Cfam_GSD_1.0
Tmem119
TMEM119
TMEM119 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 103,787,911 - 103,796,217 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 103,788,407 - 103,789,249 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 141,300,326 - 141,308,958 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tmem119
.
Predicted Target Of
Count of predictions: 739 Count of miRNA genes: 463 Interacting mature miRNAs: 532 Transcripts: ENSMUST00000067853, ENSMUST00000160374 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10045978 Tir10_m trypanosome infection response 10 (mouse) Not determined 5 98019649 114021986 Mouse 1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 25314310 Syncl4_m synaptonemal complex length 4 (mouse) 5 103047866 115538059 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 1357725 Eae39_m experimental allergic encephalomyelitis 39 (mouse) Not determined 5 89418876 118864028 Mouse 14746986 Manh58_m mandible shape 58 (mouse) 5 102446283 136446283 Mouse 25314317 Sccor3_m synaptonemal complex length to mean MLH1 count ratio 3 (mouse) 5 104347866 114738061 Mouse 1300993 Hycdc_m hypercapnic duty cycle (mouse) Not determined 5 90561006 124561151 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 1300659 Pcd8ts1_m p-glycoprotein positive CD8 T cell subset 1 (mouse) Not determined 5 97021753 131021986 Mouse 1301042 Elmaz1_m elevated maze behavior 1 (mouse) Not determined 5 98019649 116876624 Mouse 1300913 Bwefm_m body weight females and males day 10 (mouse) Not determined 5 109439348 143439459 Mouse 10402486 Dipa1_m drug induced psychomotor activation 1 (mouse) Not determined 5 95465549 129465722 Mouse 1357886 Diht_m dopamine-induced hypothermia (mouse) Not determined 5 104498738 115101540 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 10412202 Bbaa26_m B.burgdorferi-associated arthritis 26 (mouse) Not determined 5 104583688 138555455 Mouse 1301543 Hypch_m hypercholesterolemia (mouse) Not determined 5 109238624 139118905 Mouse 12904945 Tammq2_m tibialis anterior muscle mass QTL 2 (mouse) 5 100665965 134665965 Mouse 4142473 Chlq11_m circulating hormone level QTL 11 (mouse) Not determined 5 107906299 141906412 Mouse 1301419 Cypr3_m cytokine production 3 (mouse) Not determined 5 81019649 115019803 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 12904959 Smmq1_m soleus muscle mass QTL 1 (mouse) 5 100665965 134665965 Mouse 10412197 Bbaa25_m B.burgdorferi-associated arthritis 25 (mouse) Not determined 5 109167240 143167381 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 1301457 Cfsw2_m cystic fibrosis survival to weaning 2 (mouse) Not determined 5 90561006 124561151 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 1301974 Chab7_m cholesterol absorption 7 (mouse) Not determined 5 95233214 129233330 Mouse 11528550 Sluc33_m susceptibility to lung cancer 33 (mouse) 5 104386871 120711986 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 10412239 Alpq7_m alcohol preference QTL 7 (mouse) Not determined 5 104705939 138705939 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 9587780 Afw16_m abdominal fat weight QTL 16 (mouse) Not determined 5 92830166 126830285 Mouse 1357644 Egrd1_m early growth rate, direct effect 1 (mouse) Not determined 5 95434580 129434786 Mouse 12859290 Criq2_m Citrobacter rodentium infection QTL 2 (mouse) 5 101332579 135332579 Mouse 1300940 Actd3_m activity-distance traveled 3 (mouse) Not determined 5 96320385 130320533 Mouse 10755524 Mono1_m monocyte differential 1 (mouse) 5 80849259 114849259 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1558774 Lith17_m lithogenic gene 17 (mouse) Not determined 5 95465549 129465722 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 1301624 Aevm2_m autoimmune extremity vasculitis in MRL mice 2 (mouse) Not determined 5 101863832 135864028 Mouse 10043890 Trigq4_m triglyceride QTL 4 (mouse) Not determined 5 107906299 141906412 Mouse 4141652 Mrdq2_m modifier of retinal degeneration QTL 2 (mouse) Not determined 110253106 118093673 Mouse 4141139 Hmtb4_m hemostasis and thrombosis rebleeding time 4 (mouse) Not determined 108762509 126882944 Mouse 11532736 Sluc33b_m susceptibility to lung cancer 33b (mouse) 5 102945037 136945196 Mouse 4141519 Hmtb5_m hemostasis and thrombosis bleeding time 5 (mouse) Not determined 99949422 126882944 Mouse 1301858 Smdq1_m segregation of mitochondrial DNA QTL 1 (mouse) Not determined 5 97021753 131021986 Mouse 11049562 Lmr24f_m leishmaniasis resistance 24f (mouse) 5 90320962 124321041 Mouse 13464251 Ahl21_m age related hearing loss, early onset 21 (mouse) 5 109167240 143167381 Mouse 13464244 Ahl19_m age related hearing loss, early onset 19 (mouse) 5 95465549 129465722 Mouse 1300968 Skts4_m skin tumor susceptibility 4 (mouse) Not determined 5 89418876 124238239 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 1301102 Cia14_m collagen induced arthritis 14 (mouse) Not determined 5 113320385 138555455 Mouse 13464243 Ahl20_m age related hearing loss, early onset 20 (mouse) 5 107906299 141906412 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
AW208946
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 113,793,767 - 113,793,908 UniSTS GRCm38 MGSCv37 5 114,243,776 - 114,243,917 UniSTS GRCm37 Celera 5 110,894,876 - 110,895,017 UniSTS Cytogenetic Map 5 F UniSTS Whitehead/MRC_RH 5 1366.58 UniSTS
UniSTS:235267
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 113,794,661 - 113,794,872 UniSTS GRCm38 MGSCv37 5 114,244,670 - 114,244,881 UniSTS GRCm37 Celera 5 110,895,770 - 110,895,981 UniSTS Cytogenetic Map 5 F UniSTS
Tmem119
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 113,793,771 - 113,793,948 UniSTS GRCm38 MGSCv37 5 114,243,780 - 114,243,957 UniSTS GRCm37 Celera 5 110,894,880 - 110,895,057 UniSTS Cytogenetic Map 5 F UniSTS cM Map 5 UniSTS
Tmem119
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 113,793,845 - 113,793,915 UniSTS GRCm38 MGSCv37 5 114,243,854 - 114,243,924 UniSTS GRCm37 Celera 5 110,894,954 - 110,895,024 UniSTS Cytogenetic Map 5 F UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000067853 ⟹ ENSMUSP00000070551
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 113,931,790 - 113,938,577 (-) Ensembl GRCm38.p6 Ensembl 5 113,793,729 - 113,800,516 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000160374 ⟹ ENSMUSP00000124226
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 113,933,699 - 113,938,507 (-) Ensembl GRCm38.p6 Ensembl 5 113,795,638 - 113,800,446 (-) Ensembl
RefSeq Acc Id:
NM_001425854 ⟹ NP_001412783
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 113,931,790 - 113,938,457 (-) NCBI
RefSeq Acc Id:
NM_146162 ⟹ NP_666274
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 113,931,790 - 113,938,457 (-) NCBI GRCm38 5 113,793,729 - 113,800,396 (-) NCBI MGSCv37 5 114,243,738 - 114,250,367 (-) RGD Celera 5 110,894,838 - 110,901,705 (-) RGD cM Map 5 ENTREZGENE
Sequence:
AGAGCAGCTGGCGGCAGACGGCAGGCAGACAGTCAGACCGTCTAGCGGGCCTGGCTTGCCTACCTGGCAGCTGCACCCGGTCCTTCACCCAGAGCTGGTTCCATAGCTCAACATGGTCCCCTGGTTCC
hide sequence
RefSeq Acc Id:
NP_666274 ⟸ NM_146162
- Peptide Label:
precursor
- UniProtKB:
Q8BP14 (UniProtKB/Swiss-Prot), Q8R138 (UniProtKB/Swiss-Prot)
- Sequence:
MVPWFLLSLLLLARPVPGVAYSVSLPASFLEDVAGSGEAEGSSASSPSLPPPGTPAFSPTPERPQPTALDGPVPPTNLLEGIMDFFRQYVMLIAVVGSLTFLIMFIVCAALITRQKHKATAYYPSSFP
hide sequence
Ensembl Acc Id:
ENSMUSP00000070551 ⟸ ENSMUST00000067853
Ensembl Acc Id:
ENSMUSP00000124226 ⟸ ENSMUST00000160374
RefSeq Acc Id:
NP_001412783 ⟸ NM_001425854
- Peptide Label:
precursor
- UniProtKB:
Q8R138 (UniProtKB/Swiss-Prot), Q8BP14 (UniProtKB/Swiss-Prot)
RGD ID: 6887646 Promoter ID: EPDNEW_M7274 Type: initiation region Name: Tmem119_1 Description: Mus musculus transmembrane protein 119 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 113,800,381 - 113,800,441 EPDNEW
RGD ID: 6838504 Promoter ID: MM_KWN:43520 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, Kidney, Lung, MEF_B4, MEF_B6 Transcripts: OTTMUST00000071297, OTTMUST00000071298 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 114,250,069 - 114,250,569 (-) MPROMDB
