Symbol:
Wdr37
Name:
WD repeat domain 37
RGD ID:
1314667
MGI Page
MGI
Description:
Involved in lymphocyte homeostasis. Acts upstream of or within corpus callosum development. Predicted to be located in cytoplasm and nucleus. Is expressed in nervous system and neural retina. Human ortholog(s) of this gene implicated in neurooculocardiogenitourinary syndrome. Orthologous to human WDR37 (WD repeat domain 37).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
4933417A01Rik; 6430603N07; AI481191; mKIAA0982; WD repeat-containing protein 37
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WDR37 (WD repeat domain 37) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Wdr37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wdr37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WDR37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WDR37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wdr37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WDR37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WDR37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wdr37 (WD repeat domain 37) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Wdr37 (WD repeat domain 37)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
WDR37 (WD repeat domain 37)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wdr37 (WD repeat domain 37)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG12333
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C05D2.10
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
wdr37
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 8,853,002 - 8,922,136 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 8,853,004 - 8,921,945 (-) Ensembl GRCm39 Ensembl GRCm38 13 8,802,966 - 8,872,100 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 8,802,968 - 8,871,909 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 8,802,214 - 8,870,976 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 8,802,214 - 8,870,976 (-) NCBI MGSCv36 mm8 Celera 13 8,747,168 - 8,815,705 (-) NCBI Celera Cytogenetic Map 13 A1 NCBI cM Map 13 3.6 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wdr37 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR37 mRNA CTD PMID:36331819 Wdr37 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of WDR37 mRNA CTD PMID:28960355 Wdr37 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of WDR37 mRNA CTD PMID:22206623 Wdr37 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of WDR37 mRNA CTD PMID:17942748 Wdr37 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of WDR37 mRNA CTD PMID:39298647 Wdr37 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of WDR37 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to WDR37 promoter] CTD PMID:17942748 and PMID:19654925 Wdr37 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Wdr37 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of WDR37 mRNA CTD PMID:33387578 Wdr37 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO WDR37 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of WDR37 mRNA CTD PMID:22574217 Wdr37 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of WDR37 mRNA CTD PMID:21570461 Wdr37 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of WDR37 mRNA CTD PMID:39298647 Wdr37 Mouse aconitine increases expression ISO Wdr37 (Rattus norvegicus) 6480464 Aconitine results in increased expression of WDR37 protein CTD PMID:33236894 Wdr37 Mouse acrolein multiple interactions ISO WDR37 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of WDR37 mRNA more ... CTD PMID:32699268 and PMID:32845096 Wdr37 Mouse acrylamide decreases expression ISO Wdr37 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of WDR37 mRNA CTD PMID:28959563 Wdr37 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of WDR37 mRNA CTD PMID:19770486 Wdr37 Mouse aflatoxin B1 affects methylation ISO WDR37 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of WDR37 intron CTD PMID:30157460 Wdr37 Mouse aflatoxin B1 decreases methylation ISO WDR37 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of WDR37 exon and Aflatoxin B1 results in decreased methylation of WDR37 gene CTD PMID:27153756 and PMID:30157460 Wdr37 Mouse Aflatoxin B2 alpha affects methylation ISO WDR37 (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of WDR37 intron CTD PMID:30157460 Wdr37 Mouse all-trans-retinoic acid increases expression ISO WDR37 (Homo sapiens) 6480464 Tretinoin results in increased expression of WDR37 mRNA CTD PMID:33167477 Wdr37 Mouse alpha-pinene multiple interactions ISO WDR37 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of WDR37 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of WDR37 mRNA CTD PMID:32699268 Wdr37 Mouse amitrole decreases expression ISO Wdr37 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of WDR37 mRNA CTD PMID:38685447 Wdr37 Mouse arsane affects methylation ISO WDR37 (Homo sapiens) 6480464 Arsenic affects the methylation of WDR37 gene CTD PMID:25304211 Wdr37 Mouse arsenic atom affects methylation ISO WDR37 (Homo sapiens) 6480464 Arsenic affects the methylation of WDR37 gene CTD PMID:25304211 Wdr37 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of WDR37 mRNA CTD PMID:22228805 Wdr37 Mouse benzo[a]pyrene affects methylation ISO WDR37 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of WDR37 exon CTD PMID:30157460 Wdr37 Mouse benzo[a]pyrene increases methylation ISO WDR37 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of WDR37 5' UTR CTD PMID:27901495 Wdr37 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO WDR37 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Wdr37 Mouse bisphenol A increases expression ISO Wdr37 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of WDR37 mRNA CTD PMID:25181051 Wdr37 Mouse bisphenol A multiple interactions ISO WDR37 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of WDR37 gene CTD PMID:31601247 Wdr37 Mouse bisphenol A decreases expression ISO WDR37 (Homo sapiens) 6480464 bisphenol A results in decreased expression of WDR37 protein CTD PMID:37664457 Wdr37 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of WDR37 mRNA CTD PMID:29279043 Wdr37 Mouse cyclosporin A decreases expression ISO WDR37 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of WDR37 mRNA CTD PMID:20106945 Wdr37 Mouse diallyl trisulfide increases expression ISO WDR37 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of WDR37 mRNA CTD PMID:34995734 Wdr37 Mouse Dibutyl phosphate affects expression ISO WDR37 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of WDR37 mRNA CTD PMID:37042841 Wdr37 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of WDR37 mRNA CTD PMID:26730594 Wdr37 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of WDR37 mRNA CTD PMID:30319688 Wdr37 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of WDR37 mRNA CTD PMID:25629700 Wdr37 Mouse formaldehyde decreases expression ISO WDR37 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of WDR37 mRNA CTD PMID:20655997 Wdr37 Mouse FR900359 affects phosphorylation ISO WDR37 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of WDR37 protein CTD PMID:37730182 Wdr37 Mouse fulvestrant multiple interactions ISO WDR37 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of WDR37 gene CTD PMID:31601247 Wdr37 Mouse gentamycin increases expression ISO Wdr37 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of WDR37 mRNA CTD PMID:22061828 Wdr37 Mouse lead(0) decreases expression ISO WDR37 (Homo sapiens) 6480464 Lead results in decreased expression of WDR37 mRNA CTD PMID:19921347 Wdr37 Mouse leflunomide decreases expression ISO WDR37 (Homo sapiens) 6480464 leflunomide results in decreased expression of WDR37 mRNA CTD PMID:28988120 Wdr37 Mouse N-nitrosodiethylamine multiple interactions ISO Wdr37 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of WDR37 mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of WDR37 promoter CTD PMID:25374375 Wdr37 Mouse ozone multiple interactions ISO WDR37 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of WDR37 mRNA more ... CTD PMID:32699268 more ... Wdr37 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR37 mRNA CTD PMID:36331819 Wdr37 Mouse phenobarbital multiple interactions ISO Wdr37 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of WDR37 mRNA and [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of WDR37 promoter CTD PMID:25374375 Wdr37 Mouse phenylmercury acetate decreases expression ISO WDR37 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of WDR37 mRNA CTD PMID:26272509 Wdr37 Mouse potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of WDR37 mRNA CTD PMID:23608068 Wdr37 Mouse resveratrol multiple interactions ISO WDR37 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of WDR37 mRNA CTD PMID:23557933 Wdr37 Mouse sodium arsenite increases expression ISO WDR37 (Homo sapiens) 6480464 sodium arsenite results in increased expression of WDR37 mRNA CTD PMID:38568856 Wdr37 Mouse sodium arsenite decreases expression ISO WDR37 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of WDR37 mRNA CTD PMID:29301061 Wdr37 Mouse tebuconazole decreases expression ISO WDR37 (Homo sapiens) 6480464 tebuconazole results in decreased expression of WDR37 mRNA CTD PMID:30458266 Wdr37 Mouse temozolomide decreases expression ISO WDR37 (Homo sapiens) 6480464 Temozolomide results in decreased expression of WDR37 mRNA CTD PMID:31758290 Wdr37 Mouse thioacetamide increases expression ISO Wdr37 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of WDR37 mRNA CTD PMID:34492290 Wdr37 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of WDR37 gene CTD PMID:35295148 Wdr37 Mouse trichostatin A decreases expression ISO WDR37 (Homo sapiens) 6480464 trichostatin A results in decreased expression of WDR37 mRNA CTD PMID:26272509 Wdr37 Mouse triphenyl phosphate affects expression ISO WDR37 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of WDR37 mRNA CTD PMID:37042841 Wdr37 Mouse triticonazole decreases expression ISO Wdr37 (Rattus norvegicus) 6480464 triticonazole results in decreased expression of WDR37 mRNA CTD PMID:36084822 Wdr37 Mouse vinclozolin affects expression ISO Wdr37 (Rattus norvegicus) 6480464 vinclozolin affects the expression of WDR37 mRNA CTD PMID:19015723
Wdr37 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 8,853,002 - 8,922,136 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 8,853,004 - 8,921,945 (-) Ensembl GRCm39 Ensembl GRCm38 13 8,802,966 - 8,872,100 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 8,802,968 - 8,871,909 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 8,802,214 - 8,870,976 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 8,802,214 - 8,870,976 (-) NCBI MGSCv36 mm8 Celera 13 8,747,168 - 8,815,705 (-) NCBI Celera Cytogenetic Map 13 A1 NCBI cM Map 13 3.6 NCBI
WDR37 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 1,056,385 - 1,132,372 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 1,049,538 - 1,160,991 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 1,102,325 - 1,178,312 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 1,092,776 - 1,168,237 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 1,092,797 - 1,168,106 NCBI Celera 10 1,052,188 - 1,127,352 (+) NCBI Celera Cytogenetic Map 10 p15.3 NCBI HuRef 10 1,041,318 - 1,116,635 (+) NCBI HuRef CHM1_1 10 1,100,893 - 1,178,215 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 1,053,000 - 1,128,899 (+) NCBI T2T-CHM13v2.0
Wdr37 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 66,547,425 - 66,613,841 (+) NCBI GRCr8 mRatBN7.2 17 61,637,258 - 61,703,677 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 61,637,258 - 61,703,677 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 65,158,099 - 65,224,530 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 68,986,907 - 69,053,338 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 63,008,499 - 63,074,885 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 57,983,937 - 58,051,011 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 57,983,937 - 58,050,992 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 59,789,206 - 59,855,683 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 72,563,069 - 72,628,890 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 72,587,300 - 72,641,807 (+) NCBI Celera 17 54,421,462 - 54,487,842 (+) NCBI Celera Cytogenetic Map 17 q12.1 NCBI
Wdr37 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 30,068,306 - 30,161,762 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 30,097,046 - 30,161,762 (-) NCBI ChiLan1.0 ChiLan1.0
WDR37 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 13,582,276 - 13,665,002 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 13,587,145 - 13,670,319 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 1,093,957 - 1,172,209 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 1,140,167 - 1,217,263 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 1,140,562 - 1,217,263 (+) Ensembl panpan1.1 panPan2
WDR37 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 33,865,534 - 33,912,119 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 33,682,418 - 33,923,843 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 30,901,963 - 30,959,758 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 34,251,049 - 34,308,914 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 34,229,563 - 34,308,978 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 31,334,373 - 31,392,159 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 32,174,113 - 32,232,212 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 32,921,419 - 32,979,607 (-) NCBI UU_Cfam_GSD_1.0
Wdr37 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 36,783,577 - 36,853,643 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 12,948,358 - 13,018,631 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 12,948,803 - 13,020,555 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WDR37 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 68,427,192 - 68,535,143 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 68,416,058 - 68,529,662 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 75,322,822 - 75,361,681 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WDR37 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 1,011,478 - 1,085,569 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 1,011,726 - 1,082,773 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 6,065,581 - 6,142,557 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wdr37
.
Predicted Target Of
Count of predictions: 3705 Count of miRNA genes: 931 Interacting mature miRNAs: 1287 Transcripts: ENSMUST00000021572, ENSMUST00000054251, ENSMUST00000164183, ENSMUST00000175687, ENSMUST00000175958, ENSMUST00000176098, ENSMUST00000176329, ENSMUST00000176429, ENSMUST00000176587, ENSMUST00000176715, ENSMUST00000176813, ENSMUST00000176922, ENSMUST00000177112, ENSMUST00000177404, ENSMUST00000177409, ENSMUST00000177537 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10045625 Heal23_m wound healing/regeneration 23 (mouse) Not determined 13 3477612 37477820 Mouse 10045624 Heal24_m wound healing/regeneration (mouse) Not determined 13 3477612 37477820 Mouse 1301367 Twq1_m testis weight QTL 1 (mouse) Not determined 13 3615512 37615672 Mouse 1558898 Hpi1_m hapatic PMN infiltration 1 (mouse) Not determined 13 4414025 53101640 Mouse 10449140 Eosn2_m eosinophil differential 2 (mouse) 13 221311 34221311 Mouse 1301661 Tshp13_m tooth shape 13 (mouse) Not determined 13 1 23454672 Mouse 15039338 Nmrs34_m NAFLD-associated magnetic resonance shift 34 (mouse) 13 221311 34221311 Mouse 1301890 Adip7_m adiposity 7 (mouse) Not determined 13 1 23454672 Mouse 26884393 Humsd7_m humerus midshaft diameter 7, 16 week (mouse) 13 3950000 76048119 Mouse 1301255 Cd4ts6_m CD4 T cell subset 6 (mouse) Not determined 13 168545 34168684 Mouse 1301733 Heal3_m wound healing/regeneration 3 (mouse) Not determined 13 3680200 37680343 Mouse 1301227 Skull19_m skull morphology 19 (mouse) Not determined 13 1 23454672 Mouse 1301455 Bmd3_m bone mineral density 3 (mouse) Not determined 13 3477612 37477820 Mouse
AU017194
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 8,832,029 - 8,832,168 UniSTS GRCm38 MGSCv37 13 8,831,275 - 8,831,414 UniSTS GRCm37 Celera 13 8,776,112 - 8,776,251 UniSTS Cytogenetic Map 13 A1 UniSTS Whitehead/MRC_RH 13 131.87 UniSTS
BE200136
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 8,850,517 - 8,850,599 UniSTS GRCm38 MGSCv37 13 8,849,763 - 8,849,845 UniSTS GRCm37 Celera 13 8,794,599 - 8,794,681 UniSTS Cytogenetic Map 13 A1 UniSTS Whitehead/MRC_RH 13 138.92 UniSTS
RH132961
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 8,803,024 - 8,803,198 UniSTS GRCm38 MGSCv37 13 8,802,270 - 8,802,444 UniSTS GRCm37 Celera 13 8,747,224 - 8,747,398 UniSTS Cytogenetic Map 13 A1 UniSTS
AI481191
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 8,803,236 - 8,803,333 UniSTS GRCm38 MGSCv37 13 8,802,482 - 8,802,579 UniSTS GRCm37 Celera 13 8,747,436 - 8,747,533 UniSTS Cytogenetic Map 13 A1 UniSTS Whitehead/MRC_RH 13 146.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000021572 ⟹ ENSMUSP00000021572
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,853,031 - 8,921,080 (-) Ensembl GRCm38.p6 Ensembl 13 8,802,995 - 8,871,044 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000054251 ⟹ ENSMUSP00000062174
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,853,004 - 8,921,766 (-) Ensembl GRCm38.p6 Ensembl 13 8,802,968 - 8,871,730 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000164183 ⟹ ENSMUSP00000131469
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,902,705 - 8,921,015 (-) Ensembl GRCm38.p6 Ensembl 13 8,852,669 - 8,870,979 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000175687
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,903,709 - 8,908,811 (-) Ensembl GRCm38.p6 Ensembl 13 8,853,673 - 8,858,775 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000175958 ⟹ ENSMUSP00000135182
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,906,954 - 8,921,945 (-) Ensembl GRCm38.p6 Ensembl 13 8,856,918 - 8,871,909 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176098 ⟹ ENSMUSP00000135094
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,869,899 - 8,899,594 (-) Ensembl GRCm38.p6 Ensembl 13 8,819,863 - 8,849,558 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176329 ⟹ ENSMUSP00000135101
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,892,800 - 8,908,798 (-) Ensembl GRCm38.p6 Ensembl 13 8,842,764 - 8,858,762 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176429 ⟹ ENSMUSP00000134916
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,869,957 - 8,903,743 (-) Ensembl GRCm38.p6 Ensembl 13 8,819,921 - 8,853,707 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176587 ⟹ ENSMUSP00000135271
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,902,708 - 8,911,258 (-) Ensembl GRCm38.p6 Ensembl 13 8,852,672 - 8,861,222 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176715 ⟹ ENSMUSP00000134987
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,899,579 - 8,911,261 (-) Ensembl GRCm38.p6 Ensembl 13 8,849,543 - 8,861,225 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176813 ⟹ ENSMUSP00000135097
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,897,716 - 8,921,772 (-) Ensembl GRCm38.p6 Ensembl 13 8,847,680 - 8,871,736 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176922 ⟹ ENSMUSP00000135742
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,900,516 - 8,921,059 (-) Ensembl GRCm38.p6 Ensembl 13 8,850,480 - 8,871,023 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000177112
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,903,361 - 8,921,030 (-) Ensembl GRCm38.p6 Ensembl 13 8,853,325 - 8,870,994 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000177404 ⟹ ENSMUSP00000135785
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,911,172 - 8,921,043 (-) Ensembl GRCm38.p6 Ensembl 13 8,861,136 - 8,871,007 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000177409
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,885,425 - 8,887,270 (-) Ensembl GRCm38.p6 Ensembl 13 8,835,389 - 8,837,234 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000177537 ⟹ ENSMUSP00000135577
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,855,851 - 8,897,673 (-) Ensembl GRCm38.p6 Ensembl 13 8,805,815 - 8,847,637 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000221401
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 8,894,490 - 8,896,741 (-) Ensembl GRCm38.p6 Ensembl 13 8,844,454 - 8,846,705 (-) Ensembl
RefSeq Acc Id:
NM_001039388 ⟹ NP_001034477
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,002 - 8,921,772 (-) NCBI GRCm38 13 8,802,966 - 8,871,736 (-) NCBI MGSCv37 13 8,802,214 - 8,870,976 (-) RGD Celera 13 8,747,166 - 8,815,711 (-) NCBI cM Map 13 ENTREZGENE
Sequence:
TATCTCTACCAGGCTCTCCTGCAGCCAGCTAGCAAGACTCCCACTGAGCCCTGCCTGAGGAGCCATTCCTAGCAGATCAGCCTGTAAAGCAGTTGGATTTGAGAGATTCTGAAAGCGATTACGTTAAA
hide sequence
RefSeq Acc Id:
NM_001039389 ⟹ NP_001034478
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,900,515 - 8,921,080 (-) NCBI GRCm38 13 8,850,479 - 8,871,044 (-) NCBI MGSCv37 13 8,802,214 - 8,870,976 (-) RGD Celera 13 8,747,166 - 8,815,711 (-) NCBI cM Map 13 ENTREZGENE
Sequence:
AGTTACCGGAAGTACGGGCGCGCCAGTTCGGGTCGCCGGGTTGTGTCAGTGCGGGAATCGGCCG
hide sequence
RefSeq Acc Id:
NM_172445 ⟹ NP_766033
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,002 - 8,921,080 (-) NCBI GRCm38 13 8,802,966 - 8,871,044 (-) NCBI MGSCv37 13 8,802,214 - 8,870,976 (-) RGD Celera 13 8,747,166 - 8,815,711 (-) NCBI cM Map 13 ENTREZGENE
Sequence:
AGTTACCGGAAGTACGGGCGCGCCAGTTCGGGTCGCCGGGTTGTGTCAGTGCGGGAATCGGCCG
hide sequence
RefSeq Acc Id:
XM_006516469 ⟹ XP_006516532
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,030 - 8,921,097 (-) NCBI GRCm38 13 8,802,994 - 8,871,066 (-) NCBI
Sequence:
GAGGGCGGGACTTCCGCAGTTACCGGAAGTACGGGCGCGCCAGTTCGGGTCGCCGGGTTGTGTC
hide sequence
RefSeq Acc Id:
XM_006516470 ⟹ XP_006516533
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,030 - 8,922,136 (-) NCBI GRCm38 13 8,802,994 - 8,872,100 (-) NCBI
Sequence:
ACGATAAATTTATTTCTTCTCCAGCAAACATCTTGCATTACTGCTTCTTGAATCTGAACCTTCAGTTTTATCTTATAGGAAGAATGTTGACCCATATAGAAGGAAAATACTATCATGCTTTTACTGTA
hide sequence
RefSeq Acc Id:
XM_006516471 ⟹ XP_006516534
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,030 - 8,910,015 (-) NCBI GRCm38 13 8,802,994 - 8,859,988 (-) NCBI
Sequence:
AATACCATTGGCAGTAGTGCTTATCTAAAAAAACCAAAAGGATTATGGGCTGCCGTGGAGTTGA
hide sequence
RefSeq Acc Id:
XM_036157955 ⟹ XP_036013848
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,030 - 8,921,772 (-) NCBI
Sequence:
TATCTCTACCAGGCTCTCCTGCAGCCAGCTAGCAAGACTCCCACTGAGCCCTGCCTGAGGAGCCATTCCTAGCAGATCAGCCTTTTTTGGGCTGTGCGAGTGTTTAGGACAGATGGACTTAAAACCTG
hide sequence
RefSeq Acc Id:
XR_003950440
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,030 - 8,921,118 (-) NCBI GRCm38 13 8,802,995 - 8,871,067 (-) NCBI
Sequence:
TTTTTTTTAAGGACCATCTCTGAGGGCGGGACTTCCGCAGTTACCGGAAGTACGGGCGCGCCAG
hide sequence
RefSeq Acc Id:
XR_382013
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 8,853,030 - 8,921,118 (-) NCBI GRCm38 13 8,802,995 - 8,871,066 (-) NCBI
Sequence:
TTTTTTTTAAGGACCATCTCTGAGGGCGGGACTTCCGCAGTTACCGGAAGTACGGGCGCGCCAG
hide sequence
RefSeq Acc Id:
NP_001034477 ⟸ NM_001039388
- Peptide Label:
isoform a
- UniProtKB:
Q8CCL2 (UniProtKB/Swiss-Prot), Q8CBE3 (UniProtKB/Swiss-Prot), Q80Y96 (UniProtKB/Swiss-Prot), Q3UK24 (UniProtKB/TrEMBL)
- Sequence:
MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKA
hide sequence
RefSeq Acc Id:
NP_766033 ⟸ NM_172445
- Peptide Label:
isoform a
- UniProtKB:
Q8CCL2 (UniProtKB/Swiss-Prot), Q8CBE3 (UniProtKB/Swiss-Prot), Q80Y96 (UniProtKB/Swiss-Prot), Q3UK24 (UniProtKB/TrEMBL)
- Sequence:
MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKA
hide sequence
RefSeq Acc Id:
NP_001034478 ⟸ NM_001039389
- Peptide Label:
isoform b
- UniProtKB:
Q05BF4 (UniProtKB/TrEMBL), Q8C8P3 (UniProtKB/TrEMBL)
- Sequence:
MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAGEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKA
hide sequence
RefSeq Acc Id:
XP_006516533 ⟸ XM_006516470
- Peptide Label:
isoform X1
- UniProtKB:
Q8CCL2 (UniProtKB/Swiss-Prot), Q8CBE3 (UniProtKB/Swiss-Prot), Q80Y96 (UniProtKB/Swiss-Prot), Q3UK24 (UniProtKB/TrEMBL)
- Sequence:
MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEGQDSKLPSSVRSTLLELFGQ
hide sequence
RefSeq Acc Id:
XP_006516532 ⟸ XM_006516469
- Peptide Label:
isoform X1
- UniProtKB:
Q8CCL2 (UniProtKB/Swiss-Prot), Q8CBE3 (UniProtKB/Swiss-Prot), Q80Y96 (UniProtKB/Swiss-Prot), Q3UK24 (UniProtKB/TrEMBL)
- Sequence:
MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEGQDSKLPSSVRSTLLELFGQ
hide sequence
RefSeq Acc Id:
XP_006516534 ⟸ XM_006516471
- Peptide Label:
isoform X2
- UniProtKB:
Q3UK24 (UniProtKB/TrEMBL)
- Sequence:
MDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAGEGQAIDGAELSKGQLKT
hide sequence
Ensembl Acc Id:
ENSMUSP00000131469 ⟸ ENSMUST00000164183
Ensembl Acc Id:
ENSMUSP00000135785 ⟸ ENSMUST00000177404
Ensembl Acc Id:
ENSMUSP00000135577 ⟸ ENSMUST00000177537
Ensembl Acc Id:
ENSMUSP00000062174 ⟸ ENSMUST00000054251
Ensembl Acc Id:
ENSMUSP00000021572 ⟸ ENSMUST00000021572
Ensembl Acc Id:
ENSMUSP00000134987 ⟸ ENSMUST00000176715
Ensembl Acc Id:
ENSMUSP00000135742 ⟸ ENSMUST00000176922
Ensembl Acc Id:
ENSMUSP00000135097 ⟸ ENSMUST00000176813
Ensembl Acc Id:
ENSMUSP00000135101 ⟸ ENSMUST00000176329
Ensembl Acc Id:
ENSMUSP00000134916 ⟸ ENSMUST00000176429
Ensembl Acc Id:
ENSMUSP00000135271 ⟸ ENSMUST00000176587
Ensembl Acc Id:
ENSMUSP00000135094 ⟸ ENSMUST00000176098
Ensembl Acc Id:
ENSMUSP00000135182 ⟸ ENSMUST00000175958
RefSeq Acc Id:
XP_036013848 ⟸ XM_036157955
- Peptide Label:
isoform X1
- UniProtKB:
Q8CCL2 (UniProtKB/Swiss-Prot), Q8CBE3 (UniProtKB/Swiss-Prot), Q80Y96 (UniProtKB/Swiss-Prot), Q3UK24 (UniProtKB/TrEMBL)
RGD ID: 6823645 Promoter ID: MM_KWN:13189 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day2, 3T3L1_Day6, BoneMarrow_2Hour, BoneMarrow_4Hour, Lung, MEF_B6 Transcripts: UC007PKM.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 8,870,191 - 8,871,182 (+) MPROMDB
RGD ID: 6824482 Promoter ID: MM_KWN:13190 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, Brain, ES_Cell, Kidney, Liver, MEF_B4, MEF_B6, Spleen Transcripts: NM_001039388, NM_001039389, NM_172445, UC007PKK.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 8,870,316 - 8,870,947 (-) MPROMDB
RGD ID: 8679546 Promoter ID: EPDNEW_M17804 Type: single initiation site Name: Wdr37_3 Description: Mus musculus WD repeat domain 37 , transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M17805 EPDNEW_M17806 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 8,870,729 - 8,870,789 EPDNEW
RGD ID: 8679548 Promoter ID: EPDNEW_M17805 Type: initiation region Name: Wdr37_1 Description: Mus musculus WD repeat domain 37 , transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M17804 EPDNEW_M17806 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 8,871,013 - 8,871,073 EPDNEW
RGD ID: 8679550 Promoter ID: EPDNEW_M17806 Type: initiation region Name: Wdr37_2 Description: Mus musculus WD repeat domain 37 , transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M17804 EPDNEW_M17805 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 8,871,716 - 8,871,776 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Wdr37
WD repeat domain 37
3110035P10Rik
RIKEN cDNA 3110035P10 gene
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
3110035P10Rik
RIKEN cDNA 3110035P10 gene
Wdr37
WD repeat domain 37
Symbol and/or name change
5135510 APPROVED
