Advanced Search (OLGA)

Gene: RNF26 (ring finger protein 26) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

RNF26

Name:

ring finger protein 26

RGD ID:

1314288

HGNC Page

HGNC:14646

Description:

Enables ubiquitin protein ligase activity. Involved in several processes, including negative regulation of defense response to virus; protein K11-linked ubiquitination; and protein localization to perinuclear region of cytoplasm. Is active in endoplasmic reticulum membrane.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

E3 ubiquitin-protein ligase RNF26; MGC2642; ring finger protein with leucine zipper

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Rnf26 (ring finger protein 26)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Rnf26 (ring finger protein 26)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Rnf26 (ring finger protein 26)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	RNF26 (ring finger protein 26)	NCBI	Ortholog
Canis lupus familiaris (dog):	RNF26 (ring finger protein 26)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rnf26 (ring finger protein 26)	NCBI	Ortholog
Sus scrofa (pig):	RNF26 (ring finger protein 26)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	RNF26 (ring finger protein 26)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Rnf26 (ring finger protein 26)	NCBI	Ortholog
Other homologs ²
Mus musculus (house mouse):	Rnf26rt (ring finger protein 26, retrotransposed)	HGNC	EggNOG, Ensembl, Inparanoid, OrthoMCL, Panther, Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Rnf26 (ring finger protein 26)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rnf26 (ring finger protein 26)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rnf26rt (ring finger protein 26, retrotransposed)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rnf26 (ring finger protein 26)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	C56A3.4	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG2617	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	rnf26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	rnf26.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	119,334,527 - 119,337,309 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	119,334,527 - 119,337,309 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	119,205,237 - 119,208,019 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	118,710,447 - 118,713,232 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	118,710,446 - 118,713,231	NCBI
Celera	11	116,365,908 - 116,368,693 (+)	NCBI		Celera
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	115,145,909 - 115,148,723 (+)	NCBI		HuRef
CHM1_1	11	119,091,769 - 119,094,583 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	119,355,164 - 119,357,946 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RNF26	Human	CD3epsilon deficiency		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: CD3epsilon deficiency	ClinVar	PMID:28492532
RNF26	Human	chromosome 11 partial duplication syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Distal trisomy 11q	ClinVar	PMID:25741868
RNF26	Human	Dwarfism		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Short stature	ClinVar	PMID:32581362
RNF26	Human	immunodeficiency 17		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Immunodeficiency 17 and CD3 gamma deficient	ClinVar	PMID:28492532
RNF26	Human	immunodeficiency 18		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Immunodeficiency 18	ClinVar	PMID:28492532
RNF26	Human	immunodeficiency 19		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Immunodeficiency 19	ClinVar	PMID:28492532
RNF26	Human	inflammatory bowel disease 28		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Inflammatory bowel disease 28	ClinVar	PMID:28492532
RNF26	Human	isolated microphthalmia 5		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Isolated microphthalmia 5	ClinVar	PMID:28492532
RNF26	Human	RASopathy		IAGP	(Homo sapiens) and (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy	ClinVar	PMID:28492532
RNF26	Human	schizophrenia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RNF26	Human	(-)-epigallocatechin 3-gallate	multiple interactions	EXP		6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RNF26 mRNA	CTD	PMID:22079256
RNF26	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Rnf26 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of RNF26 mRNA	CTD	PMID:21570461
RNF26	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of RNF26 mRNA	CTD	PMID:33387578
RNF26	Human	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Rnf26 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of RNF26 mRNA	CTD	PMID:26251327
RNF26	Human	3,4-methylenedioxymethamphetamine	increases methylation	ISO	Rnf26 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of RNF26 promoter	CTD	PMID:26251327
RNF26	Human	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RNF26 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RNF26 mRNA	CTD	PMID:28628672
RNF26	Human	4,4'-diaminodiphenylmethane	increases expression	ISO	Rnf26 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of RNF26 mRNA	CTD	PMID:18648102
RNF26	Human	acetylsalicylic acid	increases expression	EXP		6480464	Aspirin results in increased expression of RNF26 mRNA	CTD	PMID:11906190
RNF26	Human	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of RNF26 mRNA	CTD	PMID:32763439
RNF26	Human	aflatoxin B1	decreases expression	ISO	Rnf26 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of RNF26 mRNA	CTD	PMID:19770486
RNF26	Human	amphetamine	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Amphetamine results in decreased expression of RNF26 mRNA	CTD	PMID:30779732
RNF26	Human	aristolochic acid A	increases expression	EXP		6480464	aristolochic acid I results in increased expression of RNF26 mRNA	CTD	PMID:33212167
RNF26	Human	atrazine	increases expression	EXP		6480464	Atrazine results in increased expression of RNF26 mRNA	CTD	PMID:22378314
RNF26	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of RNF26 promoter	CTD	PMID:27901495
RNF26	Human	benzo[a]pyrene diol epoxide I	decreases expression	EXP		6480464	7 more ...	CTD	PMID:20382639
RNF26	Human	bisphenol A	increases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of RNF26 mRNA	CTD	PMID:25181051 and PMID:34947998
RNF26	Human	bisphenol A	decreases expression	ISO	Rnf26 (Mus musculus)	6480464	bisphenol A results in decreased expression of RNF26 mRNA	CTD	PMID:35598803
RNF26	Human	bisphenol A	increases methylation	ISO	Rnf26 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of RNF26 gene	CTD	PMID:28505145
RNF26	Human	bisphenol A	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RNF26 mRNA	CTD	PMID:28628672
RNF26	Human	bisphenol F	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RNF26 mRNA	CTD	PMID:28628672
RNF26	Human	bisphenol F	increases expression	ISO	Rnf26 (Mus musculus)	6480464	bisphenol F results in increased expression of RNF26 mRNA	CTD	PMID:38685157
RNF26	Human	buspirone	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Buspirone results in decreased expression of RNF26 mRNA	CTD	PMID:24136188
RNF26	Human	cadmium dichloride	increases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Cadmium Chloride results in increased expression of RNF26 mRNA	CTD	PMID:33453195
RNF26	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of RNF26 mRNA	CTD	PMID:38568856
RNF26	Human	carbon nanotube	increases expression	ISO	Rnf26 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
RNF26	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to RNF26 gene]	CTD	PMID:28238834
RNF26	Human	chromium(6+)	multiple interactions	EXP		6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of RNF26 mRNA	CTD	PMID:38479592
RNF26	Human	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of RNF26 mRNA	CTD	PMID:27594783
RNF26	Human	cobalt dichloride	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	cobaltous chloride results in decreased expression of RNF26 mRNA	CTD	PMID:24386269
RNF26	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of RNF26 mRNA	CTD	PMID:19549813
RNF26	Human	coumestrol	increases expression	EXP		6480464	Coumestrol results in increased expression of RNF26 mRNA	CTD	PMID:19167446
RNF26	Human	coumestrol	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2 more ...	CTD	PMID:19167446
RNF26	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of RNF26 mRNA	CTD	PMID:25562108
RNF26	Human	dexamethasone	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RNF26 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RNF26 mRNA	CTD	PMID:28628672
RNF26	Human	dicrotophos	increases expression	EXP		6480464	dicrotophos results in increased expression of RNF26 mRNA	CTD	PMID:28302478
RNF26	Human	Enterolactone	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RNF26 mRNA	CTD	PMID:19167446
RNF26	Human	epoxiconazole	decreases expression	ISO	Rnf26 (Mus musculus)	6480464	epoxiconazole results in decreased expression of RNF26 mRNA	CTD	PMID:35436446
RNF26	Human	ethanol	affects expression	ISO	Rnf26 (Mus musculus)	6480464	Ethanol affects the expression of RNF26 mRNA	CTD	PMID:30319688
RNF26	Human	hydrogen peroxide	affects expression	EXP		6480464	Hydrogen Peroxide affects the expression of RNF26 mRNA	CTD	PMID:20044591
RNF26	Human	hypochlorous acid	decreases expression	ISO	Rnf26 (Mus musculus)	6480464	Hypochlorous Acid results in decreased expression of RNF26 mRNA	CTD	PMID:19376150
RNF26	Human	indometacin	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RNF26 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RNF26 mRNA	CTD	PMID:28628672
RNF26	Human	leflunomide	decreases expression	EXP		6480464	leflunomide results in decreased expression of RNF26 mRNA	CTD	PMID:28988120
RNF26	Human	methyl methanesulfonate	decreases expression	EXP		6480464	Methyl Methanesulfonate results in decreased expression of RNF26 mRNA	CTD	PMID:23649840
RNF26	Human	nimesulide	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	nimesulide results in decreased expression of RNF26 mRNA	CTD	PMID:24136188
RNF26	Human	nitrofen	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	nitrofen results in decreased expression of RNF26 mRNA	CTD	PMID:26720608
RNF26	Human	ozone	multiple interactions	ISO	Rnf26 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of RNF26 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of RNF26 mRNA	CTD	PMID:34911549
RNF26	Human	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of RNF26 mRNA	CTD	PMID:22230336
RNF26	Human	paracetamol	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of RNF26 mRNA	CTD	PMID:33387578
RNF26	Human	pirinixic acid	increases expression	ISO	Rnf26 (Mus musculus)	6480464	pirinixic acid results in increased expression of RNF26 mRNA	CTD	PMID:17426115
RNF26	Human	potassium chromate	multiple interactions	EXP		6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RNF26 mRNA	CTD	PMID:22079256
RNF26	Human	potassium chromate	decreases expression	EXP		6480464	potassium chromate(VI) results in decreased expression of RNF26 mRNA	CTD	PMID:22079256
RNF26	Human	resveratrol	multiple interactions	EXP		6480464	[Coumestrol co-treated with Resveratrol] results in increased expression of RNF26 mRNA and [Plant Extracts co-treated with Resveratrol] results in decreased expression of RNF26 mRNA	CTD	PMID:19167446 and PMID:23557933
RNF26	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of RNF26 mRNA	CTD	PMID:38568856
RNF26	Human	sulindac	decreases expression	EXP		6480464	Sulindac results in decreased expression of RNF26 mRNA	CTD	PMID:11906190
RNF26	Human	thioacetamide	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Thioacetamide results in decreased expression of RNF26 mRNA	CTD	PMID:34492290
RNF26	Human	thiram	decreases expression	EXP		6480464	Thiram results in decreased expression of RNF26 mRNA	CTD	PMID:38568856
RNF26	Human	trichloroethene	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of RNF26 mRNA	CTD	PMID:33387578
RNF26	Human	trimellitic anhydride	increases expression	ISO	Rnf26 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of RNF26 mRNA	CTD	PMID:19042947
RNF26	Human	troglitazone	decreases expression	ISO	Rnf26 (Mus musculus)	6480464	troglitazone results in decreased expression of RNF26 mRNA	CTD	PMID:28973697
RNF26	Human	trovafloxacin	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	trovafloxacin results in decreased expression of RNF26 mRNA	CTD	PMID:24136188
RNF26	Human	vinclozolin	decreases expression	ISO	Rnf26 (Rattus norvegicus)	6480464	vinclozolin results in decreased expression of RNF26 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RNF26	Human	endosome organization	involved_in	IDA		150520179	PMID:27368102	UniProt	PMID:27368102
RNF26	Human	negative regulation of defense response to virus	involved_in	IDA		150520179	PMID:25254379	UniProt	PMID:25254379
RNF26	Human	protein K11-linked ubiquitination	involved_in	IDA		150520179	PMID:25254379	UniProt	PMID:25254379
RNF26	Human	protein localization to perinuclear region of cytoplasm	involved_in	IDA		150520179	PMID:27368102	UniProt	PMID:27368102
RNF26	Human	protein ubiquitination	involved_in	IDA		150520179	PMID:27368102	UniProt	PMID:27368102
RNF26	Human	protein ubiquitination	involved_in	IBA	PANTHER:PTN001099707 and UniProtKB:Q9BY78	150520179		GO_Central	GO_REF:0000033
RNF26	Human	protein ubiquitination	involved_in	IEA	UniPathway:UPA00143	150520179		UniProt	GO_REF:0000041
RNF26	Human	regulation of type I interferon production	involved_in	IDA		150520179	PMID:25254379	UniProt	PMID:25254379
RNF26	Human	ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN001099707 more ...	150520179		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RNF26	Human	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	150520179		UniProt	GO_REF:0000043
RNF26	Human	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	150520179		UniProt	GO_REF:0000044
RNF26	Human	endoplasmic reticulum membrane	is_active_in	IDA		150520179	PMID:33472082	UniProt	PMID:33472082
RNF26	Human	endoplasmic reticulum membrane	located_in	IDA		150520179	PMID:25254379 and PMID:27368102	UniProt	PMID:25254379 and PMID:27368102
RNF26	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RNF26	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
RNF26	Human	protein binding	enables	IPI	UniProtKB:P11802 and UniProtKB:Q92574	150520179	PMID:38890443	IntAct	PMID:38890443
RNF26	Human	protein binding	enables	IPI	UniProtKB:Q0VD86	150520179	PMID:21750715	IntAct	PMID:21750715
RNF26	Human	protein binding	enables	IPI	UniProtKB:Q13501	150520179	PMID:27368102	UniProt	PMID:27368102
RNF26	Human	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	150520179		UniProt	GO_REF:0000043
RNF26	Human	ubiquitin protein ligase activity	enables	IDA		150520179	PMID:25254379 more ...	UniProt	PMID:25254379 more ...
RNF26	Human	ubiquitin protein ligase activity	enables	IBA	PANTHER:PTN001099707 and UniProtKB:Q9BY78	150520179		GO_Central	GO_REF:0000033
RNF26	Human	zinc ion binding	enables	NAS		150520179	PMID:11352657	UniProt	PMID:11352657
RNF26	Human	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	150520179		UniProt	GO_REF:0000043

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RNF26	Human	Schizophrenia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311
RNF26	Human	Short stature		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Short stature	ClinVar	PMID:32581362

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11352657	PMID:12477932	PMID:14702039	PMID:15489334	PMID:16303743	PMID:18187620	PMID:18976975	PMID:19549727	PMID:19690564	PMID:19913121	PMID:20628086	PMID:21750715
PMID:21873635	PMID:25254379	PMID:26186194	PMID:27368102	PMID:28514442	PMID:28786561	PMID:30759391	PMID:32614325	PMID:33087821	PMID:33472082	PMID:33961781	PMID:35281267
PMID:36224200	PMID:37519262	PMID:38890443

RNF26
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	119,334,527 - 119,337,309 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	119,334,527 - 119,337,309 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	119,205,237 - 119,208,019 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	118,710,447 - 118,713,232 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	118,710,446 - 118,713,231	NCBI
Celera	11	116,365,908 - 116,368,693 (+)	NCBI		Celera
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	115,145,909 - 115,148,723 (+)	NCBI		HuRef
CHM1_1	11	119,091,769 - 119,094,583 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	119,355,164 - 119,357,946 (+)	NCBI		T2T-CHM13v2.0

Rnf26
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	44,022,078 - 44,024,348 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	43,977,624 - 44,024,797 (-)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	9	44,006,928 - 44,024,814 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	44,110,781 - 44,113,051 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	44,095,631 - 44,113,517 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	9	44,066,327 - 44,113,500 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	43,918,864 - 43,921,134 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	43,861,776 - 43,864,046 (-)	NCBI		MGSCv36	mm8
Celera	6	78,512,145 - 78,514,433 (-)	NCBI		Celera
Cytogenetic Map	9	A5.1	NCBI
cM Map	9	24.53	NCBI

Rnf26
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	53,351,388 - 53,353,586 (-)	NCBI		GRCr8
mRatBN7.2	8	44,454,551 - 44,456,745 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	44,454,292 - 44,457,331 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	49,952,792 - 49,954,990 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	48,231,502 - 48,233,700 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	46,099,121 - 46,101,309 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	48,447,113 - 48,449,311 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	48,447,113 - 48,449,311 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	47,062,942 - 47,065,140 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	47,092,910 - 47,095,108 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	47,102,330 - 47,104,426 (-)	NCBI
Celera	8	44,041,748 - 44,043,946 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

Rnf26
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	20,416,067 - 20,417,368 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	20,415,468 - 20,418,263 (+)	NCBI	ChiLan1.0	ChiLan1.0

RNF26
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	120,042,260 - 120,045,069 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	121,145,774 - 121,148,583 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	114,175,586 - 114,178,379 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	118,102,883 - 118,105,698 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	118,103,505 - 118,104,806 (+)	Ensembl	panpan1.1		panPan2

RNF26
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	14,564,949 - 14,567,756 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	14,618,431 - 14,621,237 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	14,508,302 - 14,511,107 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	5	14,646,590 - 14,649,394 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	14,550,582 - 14,553,387 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	14,590,708 - 14,593,515 (-)	NCBI		UU_Cfam_GSD_1.0

Rnf26
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	101,343,833 - 101,346,628 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936542	4,265,226 - 4,268,037 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RNF26
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	46,543,735 - 46,546,569 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	46,543,732 - 46,546,570 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	51,577,978 - 51,580,815 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RNF26
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	110,713,453 - 110,716,281 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	110,714,081 - 110,715,379 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	15,318,719 - 15,321,545 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rnf26
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624784	14,703,369 - 14,706,194 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in RNF26
43 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 11q23.3-25(chr11:116851395-134998513)x3	copy number gain	See cases [RCV000050331]	Chr11:116851395..134998513 [GRCh38] Chr11:116722111..134868407 [GRCh37] Chr11:116227321..134373617 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh38/hg38 11q23.2-23.3(chr11:113444446-120648921)x3	copy number gain	See cases [RCV000050627]	Chr11:113444446..120648921 [GRCh38] Chr11:113315168..120519630 [GRCh37] Chr11:112820378..120024840 [NCBI36] Chr11:11q23.2-23.3	pathogenic
GRCh38/hg38 11q23.3-25(chr11:118789765-134998513)x3	copy number gain	See cases [RCV000051213]	Chr11:118789765..134998513 [GRCh38] Chr11:118660474..134868407 [GRCh37] Chr11:118165684..134373617 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh38/hg38 11q23.3-25(chr11:119215032-134998654)x1	copy number loss	See cases [RCV000052715]	Chr11:119215032..134998654 [GRCh38] Chr11:119085742..134868548 [GRCh37] Chr11:118590952..134373758 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh38/hg38 11q22.1-25(chr11:100348599-135040246)x3	copy number gain	See cases [RCV000053638]	Chr11:100348599..135040246 [GRCh38] Chr11:100219331..134910140 [GRCh37] Chr11:99724541..134415350 [NCBI36] Chr11:11q22.1-25	pathogenic
NM_032015.4(RNF26):c.985C>T (p.Pro329Ser)	single nucleotide variant	Malignant melanoma [RCV000069190]	Chr11:119336107 [GRCh38] Chr11:119206817 [GRCh37] Chr11:118712027 [NCBI36] Chr11:11q23.3	not provided
GRCh38/hg38 11q23.3-25(chr11:116851372-134998526)x3	copy number gain	See cases [RCV000134064]	Chr11:116851372..134998526 [GRCh38] Chr11:116722088..134868420 [GRCh37] Chr11:116227298..134373630 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh38/hg38 11q23.2-25(chr11:112864326-131189315)x3	copy number gain	See cases [RCV000137582]	Chr11:112864326..131189315 [GRCh38] Chr11:112832130..131059210 [GRCh37] Chr11:112240259..130564420 [NCBI36] Chr11:11q23.2-25	pathogenic
GRCh38/hg38 11q23.3-25(chr11:116868935-135075271)x3	copy number gain	See cases [RCV000137453]	Chr11:116868935..135075271 [GRCh38] Chr11:116739651..134945165 [GRCh37] Chr11:116244861..134450377 [NCBI36] Chr11:11q23.3-25	pathogenic\|conflicting data from submitters
GRCh38/hg38 11q23.3-25(chr11:116806268-135075271)x3	copy number gain	See cases [RCV000138307]	Chr11:116806268..135075271 [GRCh38] Chr11:116676984..134945165 [GRCh37] Chr11:116182194..134450377 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh38/hg38 11q23.3-24.2(chr11:117333952-127709156)x3	copy number gain	See cases [RCV000139362]	Chr11:117333952..127709156 [GRCh38] Chr11:117204668..127579051 [GRCh37] Chr11:116709878..127084261 [NCBI36] Chr11:11q23.3-24.2	pathogenic
GRCh38/hg38 11q23.3-25(chr11:116851395-134998513)x3	copy number gain	See cases [RCV000148276]	Chr11:116851395..134998513 [GRCh38] Chr11:116722111..134868407 [GRCh37] Chr11:116227321..134373617 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3(chr11:115215434-120559928)x3	copy number gain	See cases [RCV000240308]	Chr11:115215434..120559928 [GRCh37] Chr11:11q23.3	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116700253-134904063)	copy number gain	not provided [RCV000767816]	Chr11:116700253..134904063 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116681007-134938470)x3	copy number gain	See cases [RCV000449449]	Chr11:116681007..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116684163-134938470)x3	copy number gain	See cases [RCV000447848]	Chr11:116684163..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)	copy number gain	See cases [RCV000511729]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)x3	copy number gain	See cases [RCV000510881]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116681007-134938470)x3	copy number gain	See cases [RCV000512291]	Chr11:116681007..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116681007-134938470)x3	copy number gain	not provided [RCV000683373]	Chr11:116681007..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3(chr11:116669751-120979377)x3	copy number gain	not provided [RCV000683365]	Chr11:116669751..120979377 [GRCh37] Chr11:11q23.3	likely pathogenic
GRCh37/hg19 11p15.5-q25(chr11:198510-134934063)x3	copy number gain	not provided [RCV000737348]	Chr11:198510..134934063 [GRCh37] Chr11:11p15.5-q25	pathogenic
Single allele	duplication	Schizophrenia [RCV000754124]	Chr11:118989374..135076622 [GRCh38] Chr11:11q23.3-25	likely pathogenic
GRCh37/hg19 11p15.5-q25(chr11:70864-134938470)x3	copy number gain	not provided [RCV000749874]	Chr11:70864..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116697066-134934063)x3	copy number gain	not provided [RCV000737686]	Chr11:116697066..134934063 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116691675-134889485)	copy number gain	not provided [RCV000767667]	Chr11:116691675..134889485 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:117830263-134938470)x3	copy number gain	not provided [RCV000848151]	Chr11:117830263..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3(chr11:118280670-119650105)x3	copy number gain	not provided [RCV001006451]	Chr11:118280670..119650105 [GRCh37] Chr11:11q23.3	uncertain significance
Single allele	deletion	Short stature [RCV001003892]	Chr11:114433313..131230466 [GRCh37] Chr11:11q23.2-25	likely pathogenic
NC_000011.9:g.(?_119077108)_(120133495_?)dup	duplication	RASopathy [RCV001314250]	Chr11:119077108..120133495 [GRCh37] Chr11:11q23.3	uncertain significance
NC_000011.9:g.104288964_134937416dup	duplication	Distal trisomy 11q [RCV001250234]	Chr11:104288964..134937416 [GRCh37] Chr11:11q22.3-25	pathogenic
NC_000011.9:g.(?_116691583)_(121500272_?)dup	duplication	Combined immunodeficiency due to CD3gamma deficiency [RCV003119252]\|Immunodeficiency 18 [RCV003109226]\|Immunodeficiency 19 [RCV003109224]\|Inflammatory bowel disease 28 [RCV003109225]\|Isolated microphthalmia 5 [RCV003119251]\|RASopathy [RCV003119250]	Chr11:116691583..121500272 [GRCh37] Chr11:11q23.3-24.1	uncertain significance
GRCh37/hg19 11q23.1-24.3(chr11:112375478-128785742)x3	copy number gain	not provided [RCV001829187]	Chr11:112375478..128785742 [GRCh37] Chr11:11q23.1-24.3	pathogenic
NC_000011.9:g.(?_116660844)_(121500272_?)dup	duplication	not provided [RCV003107886]	Chr11:116660844..121500272 [GRCh37] Chr11:11q23.3-24.1	uncertain significance
NC_000011.9:g.(?_119103138)_(121060609_?)dup	duplication	not provided [RCV003116365]	Chr11:119103138..121060609 [GRCh37] Chr11:11q23.3	uncertain significance
NC_000011.9:g.(?_117209303)_(120133495_?)dup	duplication	not provided [RCV003122151]	Chr11:117209303..120133495 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.392G>A (p.Arg131His)	single nucleotide variant	not specified [RCV004294177]	Chr11:119335514 [GRCh38] Chr11:119206224 [GRCh37] Chr11:11q23.3	uncertain significance
GRCh37/hg19 11p13-q25(chr11:32799481-134938470)x3	copy number gain	MISSED ABORTION [RCV002282973]	Chr11:32799481..134938470 [GRCh37] Chr11:11p13-q25	pathogenic
NM_032015.5(RNF26):c.968G>A (p.Arg323Gln)	single nucleotide variant	not specified [RCV004195087]	Chr11:119336090 [GRCh38] Chr11:119206800 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.434C>T (p.Ala145Val)	single nucleotide variant	not specified [RCV004092482]	Chr11:119335556 [GRCh38] Chr11:119206266 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.887A>G (p.Gln296Arg)	single nucleotide variant	not specified [RCV004170231]	Chr11:119336009 [GRCh38] Chr11:119206719 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.523G>A (p.Gly175Arg)	single nucleotide variant	not specified [RCV004075989]	Chr11:119335645 [GRCh38] Chr11:119206355 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.719T>C (p.Val240Ala)	single nucleotide variant	not specified [RCV004234948]	Chr11:119335841 [GRCh38] Chr11:119206551 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.574T>G (p.Ser192Ala)	single nucleotide variant	not specified [RCV004243945]	Chr11:119335696 [GRCh38] Chr11:119206406 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.375T>G (p.Ser125Arg)	single nucleotide variant	not specified [RCV004245556]	Chr11:119335497 [GRCh38] Chr11:119206207 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.1265G>A (p.Arg422His)	single nucleotide variant	not specified [RCV004150320]	Chr11:119336387 [GRCh38] Chr11:119207097 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.956C>T (p.Ser319Leu)	single nucleotide variant	not specified [RCV004231760]	Chr11:119336078 [GRCh38] Chr11:119206788 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.1187G>A (p.Arg396Gln)	single nucleotide variant	not specified [RCV004168461]	Chr11:119336309 [GRCh38] Chr11:119207019 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.778C>G (p.Gln260Glu)	single nucleotide variant	not specified [RCV004166813]	Chr11:119335900 [GRCh38] Chr11:119206610 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.155C>T (p.Thr52Ile)	single nucleotide variant	not specified [RCV004149409]	Chr11:119335277 [GRCh38] Chr11:119205987 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.791G>A (p.Arg264Gln)	single nucleotide variant	not specified [RCV004289706]	Chr11:119335913 [GRCh38] Chr11:119206623 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.835C>T (p.Arg279Cys)	single nucleotide variant	not specified [RCV004254168]	Chr11:119335957 [GRCh38] Chr11:119206667 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.1082C>T (p.Pro361Leu)	single nucleotide variant	not specified [RCV004272300]	Chr11:119336204 [GRCh38] Chr11:119206914 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.472G>A (p.Gly158Ser)	single nucleotide variant	not specified [RCV004248640]	Chr11:119335594 [GRCh38] Chr11:119206304 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.790C>T (p.Arg264Trp)	single nucleotide variant	not specified [RCV004290880]	Chr11:119335912 [GRCh38] Chr11:119206622 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.764C>G (p.Thr255Ser)	single nucleotide variant	not specified [RCV004348927]	Chr11:119335886 [GRCh38] Chr11:119206596 [GRCh37] Chr11:11q23.3	uncertain significance
Single allele	duplication	not provided [RCV003448710]	Chr11:102134973..134945611 [GRCh37] Chr11:11q22.2-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116683755-134937416)x3	copy number gain	not provided [RCV004442759]	Chr11:116683755..134937416 [GRCh37] Chr11:11q23.3-25	pathogenic
NM_032015.5(RNF26):c.232G>C (p.Gly78Arg)	single nucleotide variant	not specified [RCV004446721]	Chr11:119335354 [GRCh38] Chr11:119206064 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.577A>G (p.Ser193Gly)	single nucleotide variant	not specified [RCV004446722]	Chr11:119335699 [GRCh38] Chr11:119206409 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.907C>T (p.Arg303Trp)	single nucleotide variant	not specified [RCV004446724]	Chr11:119336029 [GRCh38] Chr11:119206739 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.1045C>A (p.Pro349Thr)	single nucleotide variant	not specified [RCV004446720]	Chr11:119336167 [GRCh38] Chr11:119206877 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.697T>A (p.Leu233Met)	single nucleotide variant	not specified [RCV004446723]	Chr11:119335819 [GRCh38] Chr11:119206529 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.947G>A (p.Arg316Lys)	single nucleotide variant	not specified [RCV004665505]	Chr11:119336069 [GRCh38] Chr11:119206779 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.948G>T (p.Arg316Ser)	single nucleotide variant	not specified [RCV004665506]	Chr11:119336070 [GRCh38] Chr11:119206780 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.1045C>T (p.Pro349Ser)	single nucleotide variant	not specified [RCV004665507]	Chr11:119336167 [GRCh38] Chr11:119206877 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.70C>A (p.Leu24Ile)	single nucleotide variant	not specified [RCV004665509]	Chr11:119335192 [GRCh38] Chr11:119205902 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.362A>G (p.Asn121Ser)	single nucleotide variant	not specified [RCV004858538]	Chr11:119335484 [GRCh38] Chr11:119206194 [GRCh37] Chr11:11q23.3	likely benign
NM_032015.5(RNF26):c.145A>G (p.Thr49Ala)	single nucleotide variant	not specified [RCV004858537]	Chr11:119335267 [GRCh38] Chr11:119205977 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.919C>A (p.Pro307Thr)	single nucleotide variant	not specified [RCV004858539]	Chr11:119336041 [GRCh38] Chr11:119206751 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.997C>T (p.Arg333Cys)	single nucleotide variant	not specified [RCV004847568]	Chr11:119336119 [GRCh38] Chr11:119206829 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.194T>C (p.Leu65Ser)	single nucleotide variant	not specified [RCV004847573]	Chr11:119335316 [GRCh38] Chr11:119206026 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.826C>T (p.Arg276Trp)	single nucleotide variant	not specified [RCV004847569]	Chr11:119335948 [GRCh38] Chr11:119206658 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.1247G>A (p.Arg416His)	single nucleotide variant	not specified [RCV004847571]	Chr11:119336369 [GRCh38] Chr11:119207079 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.812G>C (p.Arg271Pro)	single nucleotide variant	not specified [RCV004847572]	Chr11:119335934 [GRCh38] Chr11:119206644 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.287G>T (p.Ser96Ile)	single nucleotide variant	not specified [RCV004847570]	Chr11:119335409 [GRCh38] Chr11:119206119 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.221G>C (p.Arg74Pro)	single nucleotide variant	not specified [RCV004665508]	Chr11:119335343 [GRCh38] Chr11:119206053 [GRCh37] Chr11:11q23.3	uncertain significance
NM_032015.5(RNF26):c.97C>G (p.Leu33Val)	single nucleotide variant	not specified [RCV004114530]	Chr11:119335219 [GRCh38] Chr11:119205929 [GRCh37] Chr11:11q23.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	590
Count of miRNA genes:	431
Interacting mature miRNAs:	477
Transcripts:	ENST00000311413
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597300591	GWAS1396665_H	complement C1q tumor necrosis factor-related protein 5 measurement QTL GWAS1396665 (human)		4e-21	complement C1q tumor necrosis factor-related protein 5 measurement		11	119336631	119336632	Human
597433641	GWAS1529715_H	protein measurement QTL GWAS1529715 (human)		8e-39	protein measurement		11	119336631	119336632	Human
597109645	GWAS1205719_H	platelet count QTL GWAS1205719 (human)		5e-25	platelet quantity (VT:0003179)	platelet count (CMO:0000029)	11	119337218	119337219	Human
1559115	SCL20_H	Serum cholesterol level QTL 20 (human)	3.22	0.001213	Lipid level	LDL cholesterol	11	100442501	126442501	Human
597122475	GWAS1218549_H	blood protein measurement QTL GWAS1218549 (human)		2e-27	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	11	119336736	119336737	Human

A005D38

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	119,207,802 - 119,208,018	UniSTS	GRCh37
Build 36	11	118,713,012 - 118,713,228	RGD	NCBI36
Celera	11	116,368,473 - 116,368,689	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	115,148,501 - 115,148,717	UniSTS
GeneMap99-GB4 RH Map	11	386.42	UniSTS
Whitehead-RH Map	11	533.4	UniSTS

Bdaa7g02

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	119,207,869 - 119,207,972	UniSTS	GRCh37
Build 36	11	118,713,079 - 118,713,182	RGD	NCBI36
Celera	11	116,368,540 - 116,368,643	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	115,148,568 - 115,148,671	UniSTS
GeneMap99-GB4 RH Map	11	386.52	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4974	1726	2351	6	624	1950	465	2270	7305	6471	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_032015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB055622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK075379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK122642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL702838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AP003396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC000058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC007534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ953192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX647424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX648447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK821090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS051427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000311413 ⟹ ENSP00000312439

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	11	119,334,527 - 119,337,309 (+)	Ensembl

RefSeq Acc Id:

NM_032015 ⟹ NP_114404

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	119,334,527 - 119,337,309 (+)	NCBI
GRCh37	11	119,205,210 - 119,208,024 (+)	NCBI
Build 36	11	118,710,447 - 118,713,232 (+)	NCBI Archive
Celera	11	116,365,908 - 116,368,693 (+)	RGD
HuRef	11	115,145,909 - 115,148,723 (+)	NCBI
CHM1_1	11	119,091,769 - 119,094,583 (+)	NCBI
T2T-CHM13v2.0	11	119,355,164 - 119,357,946 (+)	NCBI

Sequence:

show sequence

ACACAAGATGGCGGCGCCCAGCGGAGTAGGGGCTGCGCTTGGGGTTTGCTGAAGCTGGCTGCCTCTCCCACTCCCCTTTTGGGTGCAAAGCGCCGCTAGCGGGAAGACGGGGGCCGGGCGGGGACAGG
GGCACCTGCGTAGCTGGACTGAGAGCCTGCGCCCAGCTTACATCGACCCCACCCGGCCCCGGCCCGACCCGACGCGACCCGATCCGATCCGATCCCATTCCATCCGTTCCTCGTCTCCTCCCGGTCTG
ACCCGTTGCCCGGCCGTGGTTCGCCACACCAGGCATCCAAAGCTGAGGTCGCTCCTACGGCCTGGGCTCGCCTTCGCTTTAGAGATGTTTGGCCTCTTCCCTCCCAAACAGCCCATCTTCAAAACCTG
GACTCTTGGACTGGCACCTGGCCACCTTTCCCTCTACCAAGACTCCACTTCCGTCTTACCCACTTCTTCCTCAGATTCTTGGTACCCCCTGGGTTGGAGACTGCTCATTTTCCTTCCAAATTAATCCC
AGACCCCCTAAAATATTGACAACCTTGACAACCCCCCAACCGAGGAGCCAGACTTTGTTTTGGACTAACTTCCATAGCCCTATCATGGAGGCAGTGTACCTGGTAGTGAATGGGTTGGGCCTGGTGCT
GGACGTGCTGACCTTGGTGTTGGACCTCAACTTCCTGCTGGTGTCCTCCCTCCTGGCTTCCCTGGCCTGGCTCCTGGCCTTCGTCTACAACCTGCCGCACACGGTACTGACTAGTCTTCTGCACTTGG
GCCGCGGAGTCTTGCTTTCATTGCTGGCCTTGATCGAAGCCGTGGTCCGGTTCACATGTGGGGGCTTGCAGGCCTTGTGTACTCTGCTGTATAGCTGCTGCTCTGGCCTAGAGAGCCTAAAGCTCCTG
GGGCACCTGGCCTCTCATGGGGCACTGCGGAGCAGGGAGATACTGCACCGGGGCGTCCTCAATGTGGTCTCCAGTGGCCATGCTTTGCTGCGCCAGGCCTGTGACATCTGTGCCATTGCCATGAGCCT
GGTGGCTTATGTGATCAACAGCCTGGTCAACATCTGCCTCATCGGCACTCAGAACCTCTTTTCCCTGGTGCTGGCCCTGTGGGATGCAGTGACCGGGCCTCTGTGGAGGATGACGGACGTAGTGGCTG
CCTTCCTAGCCCACATTTCCAGCAGTGCTGTGGCCATGGCCATCCTCCTTTGGACACCCTGCCAACTAGCCCTGGAGCTGCTGGCCTCAGCTGCCCGCCTCCTGGCCAGCTTTGTGCTTGTCAATCTC
ACTGGCTTGGTGTTGCTAGCTTGTGTGCTGGCAGTGACGGTGACTGTGTTGCATCCGGACTTCACCCTGAGGCTGGCTACCCAGGCACTCAGCCAGCTCCATGCCCGGCCATCCTACCACCGTCTTCG
AGAGGATGTCATGCGGCTCTCTCGCCTAGCACTGGGCTCAGAGGCCTGGCGCCGAGTCTGGAGCCGCAGTCTGCAGCTGGCGAGTTGGCCAAACCGGGGAGGGGCACCTGGAGCTCCCCAGGGTGACC
CTATGAGGGTATTCTCAGTTAGGACCCGGAGACAGGACACTCTTCCTGAAGCGGGGCGCAGATCAGAGGCAGAAGAGGAGGAGGCCAGGACCATCAGAGTGACACCTGTCAGGGGCCGAGAGAGGCTC
AATGAGGAGGAGCCTCCAGGTGGGCAAGACCCTTGGAAATTGCTGAAGGAGCAAGAGGAGCGGAAGAAGTGTGTCATCTGCCAGGACCAGAGCAAGACAGTGTTGCTCCTGCCCTGCCGGCATCTGTG
CCTGTGCCAGGCCTGCACTGAAATCCTGATGCGCCACCCCGTCTACCACCGCAATTGCCCGCTCTGCCGCCGGGGCATCCTGCAGACCCTCAATGTCTACCTCTGAAGCCTCCTTCCCTGCCTGCCCA
CCCCTCCATGCTCCACGCAGGCACTCACGCTAGGACAGCATTAACACCTCATCTCCGGGTCCTGGTCTGAATCCCCTCCTACCCCTGTGGCCATCCTGCCATACATCCAGGACATTGAGTTGGAAGAC
TATGATCTGGGTGGGGGCAGGATAACATGGCTTCTCTTTACCCAGTGGGTCCCTTCGATGCTGAGGGTGGTGAGTATGTCACTATGCAAGGGCCCTGAGACTATTTGCTGTGGGCTCTCCTCCAGCCT
GCCCAGGGCCCACCCAGATGCCTCTGGGGTTACCCCTGTCTGCTTCTGGTTTTTCTGTTGGAGATCTATAGGTCCTTTTCCTGCCTCCTTCACATTTCCTCCCCAGCTTTTGCGGCCACAACACATCA
GTGTCATTTGGGTGTTTTGGCAACTCAGGGGCCTTCGGATGATCTTAAACCTTTGTGTTCAGCCAGAGCCCCTGTGCCCTGGTAGGCGTTGGGGTTAGTATCTCTCGGGTGCCCTCAGAGCCACCTCT
GCCTGTGATCGTCTGATGAGGCTCCCTCCCAACCTGATCCAAAAGCCAGTCTCAGGAGTTTACCCCTGGGATGGGGGATGCATCTGCACCTGACTTTGGGGCCACGTGCCCTGTGGCACCCCAGCTCA
CTGGGAGTCTCAGGAGGGATAACCGGATTTCTGCTCTTTCCCCTGTCACTCCCACATCACACAGAAAAATGGCATTCCTCTCTGTCTCTCCCTGGCATGGAGAGGGCAGACTGTGCACATTTCACTAG
GGTCCAAATACAGAAGGGCCCAGGGCCCAGGGGCTTGCAGCTTCGTGAGGGGTCTCTGGCCCAGTTTCCAATGAATAAAGTTCTCTTGACAGCTC

hide sequence


Protein RefSeqs	NP_114404	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH00058	(Get FASTA)	NCBI Sequence Viewer
	AAH07534	(Get FASTA)	NCBI Sequence Viewer
	BAB40955	(Get FASTA)	NCBI Sequence Viewer
	BAC11580	(Get FASTA)	NCBI Sequence Viewer
	BAG53635	(Get FASTA)	NCBI Sequence Viewer
	CAI72207	(Get FASTA)	NCBI Sequence Viewer
	EAW67479	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000312439
	ENSP00000312439.4
GenBank Protein	Q9BY78	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_114404 ⟸ NM_032015

- UniProtKB:

Q542Y8 (UniProtKB/Swiss-Prot), Q9BY78 (UniProtKB/Swiss-Prot), B3KV23 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAVYLVVNGLGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRGVLLSLLALIEAVVRFTCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVLNVVSSGHA
LLRQACDICAIAMSLVAYVINSLVNICLIGTQNLFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASFVLVNLTGLVLLACVLAVTVTVLHPDFTLRLATQ
ALSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASWPNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEEPPGGQDPWKLLKEQEERKKCVICQ
DQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL

hide sequence

Ensembl Acc Id:

ENSP00000312439 ⟸ ENST00000311413

Protein Domains

RING-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9BY78-F1-model_v2	AlphaFold	Q9BY78	1-433	view protein structure

Database	Acc Id	Source(s)
COSMIC	RNF26	COSMIC
Ensembl Genes	ENSG00000173456	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000311413	ENTREZGENE
	ENST00000311413.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.40.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000173456	GTEx
HGNC ID	HGNC:14646	ENTREZGENE
Human Proteome Map	RNF26	Human Proteome Map
InterPro	RNF26_mRING-HC-C3HC5	UniProtKB/Swiss-Prot
	Znf_RING	UniProtKB/Swiss-Prot
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot
KEGG Report	hsa:79102	UniProtKB/Swiss-Prot
NCBI Gene	79102	ENTREZGENE
OMIM	606130	OMIM
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE RNF26	UniProtKB/Swiss-Prot
	E3 UBIQUITIN-PROTEIN LIGASE RNF26	UniProtKB/Swiss-Prot
Pfam	zf-C3HC4_3	UniProtKB/Swiss-Prot
PharmGKB	PA34430	PharmGKB
PROSITE	ZF_RING_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	RING/U-box	UniProtKB/Swiss-Prot
UniProt	B3KV23	ENTREZGENE, UniProtKB/TrEMBL
	Q542Y8	ENTREZGENE
	Q9BY78	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q542Y8	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar