Symbol:
ELAC1
Name:
elaC ribonuclease Z 1
RGD ID:
1312386
HGNC Page
HGNC:14197
Description:
Enables tRNA-specific ribonuclease activity. Involved in rescue of stalled ribosome and tRNA 3'-end processing. Located in cytosol and nucleoplasm.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
D29; deleted in Ma29; elaC homolog 1; elaC homolog protein 1; FLJ59261; ribonuclease Z 1; RNase Z 1; RNaseZ(S); tRNA 3 endonuclease 1; tRNA 3' processing endoribonuclease; tRNA Z (short form); tRNase Z 1; tRNase ZS; zinc phosphodiesterase ELAC protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Elac1 (elaC ribonuclease Z 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Elac1 (elaC ribonuclease Z 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Elac1 (elaC ribonuclease Z 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ELAC1 (elaC ribonuclease Z 1) NCBI
Ortholog
Canis lupus familiaris (dog):
ELAC1 (elaC ribonuclease Z 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Elac1 (elaC ribonuclease Z 1) NCBI
Ortholog
Sus scrofa (pig):
ELAC1 (elaC ribonuclease Z 1) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ELAC1 (elaC ribonuclease Z 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Elac1 (elaC ribonuclease Z 1) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Mmp24 (matrix metallopeptidase 24) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Elac1 (elaC ribonuclease Z 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Elac1 (elaC ribonuclease Z 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
elac1 (elaC ribonuclease Z 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
elac1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
elac1.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 50,968,040 - 50,988,121 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 50,967,991 - 50,988,121 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 48,494,410 - 48,514,491 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 46,748,385 - 46,768,488 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 46,748,384 - 46,768,488 NCBI Celera 18 45,351,172 - 45,371,275 (+) NCBI Celera Cytogenetic Map 18 q21.2 NCBI HuRef 18 45,349,736 - 45,369,837 (+) NCBI HuRef CHM1_1 18 48,489,814 - 48,509,914 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 51,169,751 - 51,189,833 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ELAC1 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ELAC1 mRNA CTD PMID:22079256 ELAC1 Human 1,2-dimethylhydrazine increases expression ISO RGD:1622152 6480464 1,2-Dimethylhydrazine results in increased expression of ELAC1 mRNA CTD PMID:22206623 ELAC1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1622152 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ELAC1 promoter] CTD PMID:19654925 ELAC1 Human 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1622152 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of ELAC1 mRNA CTD PMID:26251327 ELAC1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 ELAC1 Human 4-hydroxyphenyl retinamide decreases expression ISO RGD:1622152 6480464 Fenretinide results in decreased expression of ELAC1 mRNA CTD PMID:28973697 ELAC1 Human 6-propyl-2-thiouracil increases expression ISO RGD:1304757 6480464 Propylthiouracil results in increased expression of ELAC1 mRNA CTD PMID:25825206 ELAC1 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of ELAC1 gene CTD PMID:27153756 ELAC1 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of ELAC1 gene CTD PMID:25304211 ELAC1 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of ELAC1 gene CTD PMID:25304211 ELAC1 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of ELAC1 3' UTR CTD PMID:27901495 ELAC1 Human bisphenol A affects expression ISO RGD:1304757 6480464 bisphenol A affects the expression of ELAC1 mRNA CTD PMID:25181051 ELAC1 Human bisphenol A decreases expression ISO RGD:1622152 6480464 bisphenol A results in decreased expression of ELAC1 mRNA CTD PMID:33221593 ELAC1 Human bisphenol A increases methylation ISO RGD:1304757 6480464 bisphenol A results in increased methylation of ELAC1 gene CTD PMID:28505145 ELAC1 Human bisphenol A multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 ELAC1 Human bisphenol F multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 ELAC1 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of ELAC1 mRNA CTD PMID:25979313 ELAC1 Human carbon nanotube decreases expression ISO RGD:1622152 6480464 Nanotubes, Carbon analog results in decreased expression of ELAC1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 ELAC1 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ELAC1 mRNA CTD PMID:27392435 ELAC1 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ELAC1 mRNA CTD PMID:27392435 ELAC1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of ELAC1 mRNA CTD PMID:19549813 ELAC1 Human crocidolite asbestos decreases expression ISO RGD:1622152 6480464 Asbestos, Crocidolite results in decreased expression of ELAC1 mRNA CTD PMID:29279043 ELAC1 Human cylindrospermopsin increases expression EXP 6480464 cylindrospermopsin results in increased expression of ELAC1 mRNA CTD PMID:24921660 ELAC1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 ELAC1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ELAC1 mRNA CTD PMID:37042841 ELAC1 Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of ELAC1 mRNA CTD PMID:28302478 ELAC1 Human fluorescein 5-isothiocyanate affects binding EXP 6480464 Fluorescein-5-isothiocyanate binds to ELAC1 protein CTD PMID:27129696 ELAC1 Human furan increases methylation ISO RGD:1304757 6480464 furan results in increased methylation of ELAC1 gene CTD PMID:22079235 ELAC1 Human furan decreases expression ISO RGD:1622152 6480464 furan results in decreased expression of ELAC1 mRNA CTD PMID:24183702 ELAC1 Human gentamycin decreases expression ISO RGD:1304757 6480464 Gentamicins results in decreased expression of ELAC1 mRNA CTD PMID:33387578 ELAC1 Human GSK-J4 decreases expression EXP 6480464 GSK-J4 results in decreased expression of ELAC1 mRNA CTD PMID:29301935 ELAC1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 ELAC1 Human iron dichloride decreases expression EXP 6480464 ferrous chloride results in decreased expression of ELAC1 mRNA CTD PMID:35984750 ELAC1 Human ketoconazole increases expression ISO RGD:1304757 6480464 Ketoconazole results in increased expression of ELAC1 mRNA CTD PMID:36653537 ELAC1 Human lead(0) affects expression EXP 6480464 Lead affects the expression of ELAC1 mRNA CTD PMID:28903495 ELAC1 Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of ELAC1 mRNA CTD PMID:28001369 ELAC1 Human ozone multiple interactions ISO RGD:1622152 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 ELAC1 Human ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ELAC1 mRNA CTD PMID:35430440 ELAC1 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of ELAC1 mRNA CTD PMID:22079256 ELAC1 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ELAC1 mRNA CTD PMID:22079256 ELAC1 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of ELAC1 mRNA CTD PMID:23557933 ELAC1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of ELAC1 mRNA CTD PMID:25351596 ELAC1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ELAC1 mRNA CTD PMID:38568856 ELAC1 Human thimerosal increases expression EXP 6480464 Thimerosal results in increased expression of ELAC1 mRNA CTD PMID:27188386 ELAC1 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of ELAC1 mRNA CTD PMID:38568856 ELAC1 Human titanium dioxide decreases expression ISO RGD:1622152 6480464 titanium dioxide results in decreased expression of ELAC1 mRNA CTD PMID:29264374 ELAC1 Human titanium dioxide decreases methylation ISO RGD:1622152 6480464 titanium dioxide results in decreased methylation of ELAC1 promoter CTD PMID:35295148 ELAC1 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of ELAC1 mRNA CTD PMID:24935251 ELAC1 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ELAC1 mRNA CTD PMID:37042841 ELAC1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ELAC1 mRNA CTD PMID:25979313 ELAC1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ELAC1 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:28001369
ELAC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 50,968,040 - 50,988,121 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 50,967,991 - 50,988,121 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 48,494,410 - 48,514,491 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 46,748,385 - 46,768,488 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 46,748,384 - 46,768,488 NCBI Celera 18 45,351,172 - 45,371,275 (+) NCBI Celera Cytogenetic Map 18 q21.2 NCBI HuRef 18 45,349,736 - 45,369,837 (+) NCBI HuRef CHM1_1 18 48,489,814 - 48,509,914 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 51,169,751 - 51,189,833 (+) NCBI T2T-CHM13v2.0
Elac1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 73,868,109 - 73,887,589 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 73,868,109 - 73,887,550 (-) Ensembl GRCm39 Ensembl GRCm38 18 73,735,038 - 73,754,519 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 73,735,038 - 73,754,479 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 73,894,692 - 73,914,133 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 73,851,527 - 73,879,818 (-) NCBI MGSCv36 mm8 Celera 18 74,971,996 - 74,991,451 (-) NCBI Celera Cytogenetic Map 18 E2 NCBI cM Map 18 49.83 NCBI
Elac1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 69,596,475 - 69,617,206 (-) NCBI GRCr8 mRatBN7.2 18 67,321,231 - 67,341,358 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 67,323,583 - 67,340,936 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 69,431,671 - 69,449,018 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 70,106,253 - 70,123,599 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 67,971,620 - 67,988,967 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 69,706,522 - 69,723,869 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 69,706,522 - 69,723,869 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 68,848,766 - 68,868,465 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 70,512,719 - 70,530,066 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 70,587,581 - 70,603,285 (-) NCBI Celera 18 65,324,281 - 65,341,610 (-) NCBI Celera Cytogenetic Map 18 q12.2 NCBI
Elac1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 35,904,553 - 35,918,111 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 35,904,552 - 35,918,120 (+) NCBI ChiLan1.0 ChiLan1.0
ELAC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 68,486,790 - 68,508,057 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 54,179,382 - 54,200,662 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 44,339,868 - 44,359,150 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 47,692,305 - 47,706,019 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 47,692,305 - 47,706,019 (+) Ensembl panpan1.1 panPan2
ELAC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 23,931,360 - 23,971,516 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 23,960,723 - 23,969,405 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 24,944,290 - 24,956,679 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 23,848,106 - 23,861,309 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 23,846,515 - 23,862,884 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 23,909,322 - 23,921,706 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 23,795,517 - 23,807,905 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 24,042,523 - 24,082,686 (-) NCBI UU_Cfam_GSD_1.0
Elac1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 37,081,836 - 37,100,062 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 12,326,679 - 12,339,167 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 12,323,699 - 12,338,991 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ELAC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 100,514,760 - 100,535,993 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 100,514,662 - 100,536,579 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 110,449,860 - 110,467,483 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ELAC1
Elac1
.
Predicted Target Of
Count of predictions: 817 Count of miRNA genes: 628 Interacting mature miRNAs: 707 Transcripts: ENST00000269466, ENST00000586966, ENST00000588577, ENST00000591429 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
407339348 GWAS988324_H eosinophil count QTL GWAS988324 (human) 6e-10 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 18 50988025 50988026 Human 597285424 GWAS1381498_H inflammatory bowel disease QTL GWAS1381498 (human) 2e-08 inflammatory bowel disease 18 50977537 50977538 Human 597287573 GWAS1383647_H ulcerative colitis QTL GWAS1383647 (human) 0.000003 ulcerative colitis 18 50977537 50977538 Human 596979594 GWAS1099113_H ulcerative colitis QTL GWAS1099113 (human) 0.000003 ulcerative colitis 18 50977537 50977538 Human
RH45926
Human Assembly Chr Position (strand) Source JBrowse GRCh37 18 48,513,463 - 48,513,603 UniSTS GRCh37 Build 36 18 46,767,461 - 46,767,601 RGD NCBI36 Celera 18 45,370,248 - 45,370,388 RGD Cytogenetic Map 18 q21 UniSTS HuRef 18 45,368,810 - 45,368,950 UniSTS
D18S897E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 18 48,513,496 - 48,513,596 UniSTS GRCh37 Build 36 18 46,767,494 - 46,767,594 RGD NCBI36 Celera 18 45,370,281 - 45,370,381 RGD Cytogenetic Map 18 q21 UniSTS HuRef 18 45,368,843 - 45,368,943 UniSTS
ELAC1__7576
Human Assembly Chr Position (strand) Source JBrowse GRCh37 18 48,513,032 - 48,513,732 UniSTS GRCh37 Build 36 18 46,767,030 - 46,767,730 RGD NCBI36 Celera 18 45,369,817 - 45,370,517 RGD HuRef 18 45,368,379 - 45,369,079 UniSTS
SGC38219
Human Assembly Chr Position (strand) Source JBrowse GRCh37 18 48,513,112 - 48,513,362 UniSTS GRCh37 Build 36 18 46,767,110 - 46,767,360 RGD NCBI36 Celera 18 45,369,897 - 45,370,147 RGD Cytogenetic Map 18 q21 UniSTS HuRef 18 45,368,459 - 45,368,709 UniSTS GeneMap99-GB4 RH Map 18 358.19 UniSTS Whitehead-RH Map 18 374.1 UniSTS NCBI RH Map 18 605.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4973
1726
2349
6
624
1950
465
2269
7305
6471
53
3734
1
852
1743
1614
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000269466 ⟹ ENSP00000269466
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 18 50,968,040 - 50,988,121 (+) Ensembl
Ensembl Acc Id:
ENST00000586966
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 18 50,968,045 - 50,969,866 (+) Ensembl
Ensembl Acc Id:
ENST00000588577 ⟹ ENSP00000467389
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 18 50,967,991 - 50,986,946 (+) Ensembl
Ensembl Acc Id:
ENST00000591429 ⟹ ENSP00000464770
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 18 50,968,048 - 50,984,838 (+) Ensembl
RefSeq Acc Id:
NM_018696 ⟹ NP_061166
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 18 50,968,040 - 50,988,121 (+) NCBI GRCh37 18 48,494,387 - 48,514,491 (+) NCBI Build 36 18 46,748,385 - 46,768,488 (+) NCBI Archive Celera 18 45,351,172 - 45,371,275 (+) RGD HuRef 18 45,349,736 - 45,369,837 (+) RGD CHM1_1 18 48,489,814 - 48,509,914 (+) NCBI T2T-CHM13v2.0 18 51,169,751 - 51,189,833 (+) NCBI
Sequence:
GTAGCCCCGCGGACAGCTGGGCCAGGGTGCGGGCCTGCGCCTCCCTCGGCTCCTGGCGCGGGCCTCGGGGAGAGGGGTGGAAGATGTCTATGGATGTGACATTCCTGGGGACGGGTGCAGCATACCCA
hide sequence
RefSeq Acc Id:
NP_061166 ⟸ NM_018696
- UniProtKB:
Q9NS99 (UniProtKB/Swiss-Prot), Q9H777 (UniProtKB/Swiss-Prot), Q53EY2 (UniProtKB/TrEMBL)
- Sequence:
MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSMVSKQPIEIYGPVGLRDFIWRTMELSHTELVFHYVVHELVPTAD
hide sequence
Ensembl Acc Id:
ENSP00000269466 ⟸ ENST00000269466
Ensembl Acc Id:
ENSP00000467389 ⟸ ENST00000588577
Ensembl Acc Id:
ENSP00000464770 ⟸ ENST00000591429
RGD ID: 6794817 Promoter ID: HG_KWN:28028 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000255992, UC010DPE.1 Position: Human Assembly Chr Position (strand) Source Build 36 18 46,748,151 - 46,748,651 (+) MPROMDB
RGD ID: 7237349 Promoter ID: EPDNEW_H24420 Type: initiation region Name: ELAC1_1 Description: elaC ribonuclease Z 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 18 50,968,040 - 50,968,100 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-06-04
ELAC1
elaC ribonuclease Z 1
elaC homolog 1 (E. coli)
Symbol and/or name change
5135510 APPROVED
