Ngdn (neuroguidin) - Rat Genome Database

Name: Ngdn
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Ngdn (neuroguidin) Rattus norvegicus

Analyze

Symbol:

Ngdn

Name:

neuroguidin

RGD ID:

1310211

Description:

Involved in negative regulation of protein localization to plasma membrane; postsynaptic modulation of chemical synaptic transmission; and regulation of translation at postsynapse. Is active in glutamatergic synapse; perforant pathway to dendrate granule cell synapse; and postsynapse. Orthologous to human NGDN (neuroguidin); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC305887; neuroguidin, EIF4E binding protein; RGD1310211; similar to CG11030-PA

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NGDN (neuroguidin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ngdn (neuroguidin, EIF4E binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ngdn (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NGDN (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NGDN (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ngdn (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NGDN (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NGDN (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ngdn (neuroguidin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NGDN (neuroguidin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ngdn (neuroguidin, EIF4E binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ngdn (neuroguidin, EIF4E binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11030	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	LCP5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	lpd-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ngdn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	32,459,898 - 32,467,260 (+)	NCBI		GRCr8
mRatBN7.2	15	28,489,950 - 28,497,286 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	28,490,040 - 28,519,654 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,335,757 - 30,343,003 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	31,482,954 - 31,490,200 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,725,617 - 29,732,863 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,677,333 - 33,684,840 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,677,597 - 33,684,840 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	37,564,770 - 37,571,979 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,123,040 - 33,130,280 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,139,359 - 33,145,777 (+)	NCBI
Celera	15	28,068,294 - 28,075,327 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain-Lung-Thyroid Syndrome (ISO)

lysinuric protein intolerance (ISO)

Specific Granule Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

caffeine (ISO)

chromium(6+) (ISO)

clobetasol (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cylindrospermopsin (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

disulfiram (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

methimazole (EXP)

paracetamol (ISO)

phenobarbital (EXP)

SB 431542 (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (IBA)

negative regulation of protein localization to plasma membrane (IMP)

postsynaptic modulation of chemical synaptic transmission (IDA,IMP)

regulation of translation at postsynapse (IDA,IEP,IMP)

ribosomal small subunit biogenesis (ISO)

Cellular Component

filopodium (IEA)

glutamatergic synapse (IDA,IEP,IMP)

mitochondrion (IEA,ISO)

nucleolus (IBA,ISO)

nucleoplasm (IEA,ISO)

perforant pathway to dendrate granule cell synapse (IDA,IMP)

postsynapse (IDA)

small-subunit processome (IBA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Dendritic GluN2A synthesis mediates activity-induced NMDA receptor insertion.	Swanger SA, etal., J Neurosci. 2013 May 15;33(20):8898-908. doi: 10.1523/JNEUROSCI.0289-13.2013.
4.	Bidirectional control of mRNA translation and synaptic plasticity by the cytoplasmic polyadenylation complex.	Udagawa T, etal., Mol Cell. 2012 Jul 27;47(2):253-66. doi: 10.1016/j.molcel.2012.05.016. Epub 2012 Jun 21.

Additional References at PubMed

PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Ngdn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	32,459,898 - 32,467,260 (+)	NCBI		GRCr8
mRatBN7.2	15	28,489,950 - 28,497,286 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	28,490,040 - 28,519,654 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,335,757 - 30,343,003 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	31,482,954 - 31,490,200 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,725,617 - 29,732,863 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,677,333 - 33,684,840 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,677,597 - 33,684,840 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	37,564,770 - 37,571,979 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,123,040 - 33,130,280 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,139,359 - 33,145,777 (+)	NCBI
Celera	15	28,068,294 - 28,075,327 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

NGDN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	23,469,703 - 23,478,826 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	23,469,679 - 23,509,862 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	23,938,912 - 23,948,035 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,008,738 - 23,017,242 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	23,008,755 - 23,017,853	NCBI
Celera	14	3,801,578 - 3,810,079 (+)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	4,055,311 - 4,063,812 (+)	NCBI		HuRef
CHM1_1	14	23,937,565 - 23,946,068 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	17,670,297 - 17,679,414 (+)	NCBI		T2T-CHM13v2.0

Ngdn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,252,911 - 55,261,595 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,252,911 - 55,261,594 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	55,015,454 - 55,024,138 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,015,454 - 55,024,137 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	55,634,291 - 55,642,975 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	53,969,596 - 53,978,209 (+)	NCBI		MGSCv36	mm8
Celera	14	52,821,923 - 52,830,481 (+)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.03	NCBI

Ngdn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,877,343 - 36,887,031 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	36,877,343 - 36,887,031 (-)	NCBI	ChiLan1.0	ChiLan1.0

NGDN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	24,900,885 - 24,909,229 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	24,117,377 - 24,125,720 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,288,325 - 4,296,671 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	22,382,340 - 22,390,718 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	22,382,334 - 22,390,718 (+)	Ensembl	panpan1.1		panPan2

NGDN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	3,704,430 - 3,713,517 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	3,705,005 - 3,713,517 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	3,626,408 - 3,635,526 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	3,814,513 - 3,823,622 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	3,815,156 - 3,823,622 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,506,015 - 3,515,129 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	3,567,476 - 3,576,588 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	3,829,536 - 3,838,646 (+)	NCBI		UU_Cfam_GSD_1.0

Ngdn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	35,447,004 - 35,456,656 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	932,238 - 942,046 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	932,336 - 941,895 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NGDN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	75,621,334 - 75,629,447 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	81,107,079 - 81,115,187 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NGDN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	23,840,583 - 23,848,726 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	23,840,639 - 23,849,653 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	22,569,926 - 22,578,108 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ngdn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	9,092,139 - 9,102,192 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624820	9,092,270 - 9,102,189 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ngdn
40 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	43
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000024337
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Markers in Region

RH131318

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	28,496,936 - 28,497,150 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	33,684,491 - 33,684,704	NCBI	Rnor6.0
Rnor_5.0	15	37,571,630 - 37,571,843	UniSTS	Rnor5.0
RGSC_v3.4	15	33,129,931 - 33,130,144	UniSTS	RGSC3.4
Celera	15	28,074,978 - 28,075,191	UniSTS
Cytogenetic Map	15	p13	UniSTS

RH144084

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	28,488,633 - 28,488,758 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	33,676,191 - 33,676,315	NCBI	Rnor6.0
Rnor_5.0	15	37,563,364 - 37,563,488	UniSTS	Rnor5.0
RGSC_v3.4	15	33,121,634 - 33,121,758	UniSTS	RGSC3.4
Celera	15	28,066,888 - 28,067,012	UniSTS
RH 3.4 Map	15	260.0	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006251966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024337 ⟹ ENSRNOP00000024337

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	28,490,110 - 28,497,155 (+)	Ensembl
Rnor_6.0 Ensembl	15	33,677,597 - 33,684,840 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094340 ⟹ ENSRNOP00000094474

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	28,490,040 - 28,497,184 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117348 ⟹ ENSRNOP00000091706

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	28,490,068 - 28,519,654 (+)	Ensembl

RefSeq Acc Id:

NM_001107263 ⟹ NP_001100733

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,460,014 - 32,467,260 (+)	NCBI
mRatBN7.2	15	28,490,040 - 28,497,286 (+)	NCBI
Rnor_6.0	15	33,677,597 - 33,684,840 (+)	NCBI
Rnor_5.0	15	37,564,770 - 37,571,979 (+)	NCBI
RGSC_v3.4	15	33,123,040 - 33,130,280 (+)	RGD
Celera	15	28,068,294 - 28,075,327 (+)	RGD

Sequence:

show sequence

TCAGGTTAGCTCCCAGGAAGTTCGGGCCCGGAAAGGGTGGGCTTTGCGAAGATGGAGGCTCCGG
AGGTGCTGGAATCAGAGGTGTCAAGTTCGATAACACTTTTGAAAAATCTCCAGGAGCAGGTGAT
GGCTGTGACAGCACAAGTACAAGCACTGACAGCAAAAGTTCGAGCTGGAGCATATTCTACAGAG
AAGGGTCTGAGCCTCTTGGAAGTGAAAGACCAGCTGTTGCTCATGTACCTCATGGACCTGAGCC
ACCTCATCCTGGACAAGGCCTCTGGGGGCTCTCTGCAGGGACACCCTGCAGTTCTGAGGCTGGT
GGAGATTCGCACGGTTTTAGAAAAACTCCGTCCTTTGGACCAGAAGCTGAAATATCAAATTGAC
AAACTGGTCAAGACTGCAGTGACAGGCAGCCTCAGTGAGAATGACCCGCTTCGTTTTAAGCCTC
ACCCCAGCAATATGATGAGCAAGTTGAGCTCTGAGGATGAGGAGGAAAATGAAGCAGAGGAGGA
CCAGTCTGAGGCCTCGGGGAAGAAATCTGTAAAAGGCGCATCTAAGAAATACGTCCCACCACGC
TTGGTTCCGGTACATTATGATGAGACAGAAGCTGAGCGGGAACAGAAGCGTCTGGAGAAAGCCA
AGAGACGGGCGCTGAGCAGCTCCGTCATCCGTGAGCTGAAGGAGCAGTACTCAGATGCCCCGGA
AGAGATCCGTGACGTGCGACACCCTCACGTCACCCGCCAGAGTCAGGAGGATCAGCACAGGATC
AACTATGAAGAGAGCATGATGGTTCGCTTAAGTGTCAGCAAGCGAGAGAAAGGACTGCGAAGGC
GGGCGAGTGCCATGAGCTCACAGCTTCATTCCCTCACACACTTCAGCGACATCAGCGCTTTGAC
AGGGGGCACCGCTCATCTTGATGAGGACCAGAATCCTGTTAAAAAGCGGAAGAAGATGCCTAAG
AAAGGTCGGAAGAAGAAAGGTTTTCGGAGGCGCTGGTGACGAGCTTATGCATGCACTTTTGGTC
ATCACTGTGTGTAGACGTTTGCCTTGGAAATGTGGAAAGAGCTTTACTAAATAAAATTGATTTT
GTTTATGATAAAAGACATTTTTGCCATACATTGTATGATTGCAATTGCTGGGCATGGGGGCTGC
ATTCACTAAAAGGAGAGTTAGTGGAAAGGGGAAGACGATGTTTTGGGAGA

hide sequence

RefSeq Acc Id:

XM_063274248 ⟹ XP_063130318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,459,898 - 32,467,161 (+)	NCBI

RefSeq Acc Id:

XM_063274249 ⟹ XP_063130319

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,460,118 - 32,467,161 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100733	(Get FASTA)	NCBI Sequence Viewer
	XP_063130318	(Get FASTA)	NCBI Sequence Viewer
	XP_063130319	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14214	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024337.5
	ENSRNOP00000091706.1
	ENSRNOP00000094474.1

RefSeq Acc Id:

NP_001100733 ⟸ NM_001107263

- UniProtKB:

A6KGY5 (UniProtKB/TrEMBL), A0A8I6ALQ0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAPEVLESEVSSSITLLKNLQEQVMAVTAQVQALTAKVRAGAYSTEKGLSLLEVKDQLLLMYL
MDLSHLILDKASGGSLQGHPAVLRLVEIRTVLEKLRPLDQKLKYQIDKLVKTAVTGSLSENDPL
RFKPHPSNMMSKLSSEDEEENEAEEDQSEASGKKSVKGASKKYVPPRLVPVHYDETEAEREQKR
LEKAKRRALSSSVIRELKEQYSDAPEEIRDVRHPHVTRQSQEDQHRINYEESMMVRLSVSKREK
GLRRRASAMSSQLHSLTHFSDISALTGGTAHLDEDQNPVKKRKKMPKKGRKKKGFRRRW

hide sequence

Ensembl Acc Id:

ENSRNOP00000024337 ⟸ ENSRNOT00000024337

Ensembl Acc Id:

ENSRNOP00000094474 ⟸ ENSRNOT00000094340

Ensembl Acc Id:

ENSRNOP00000091706 ⟸ ENSRNOT00000117348

RefSeq Acc Id:	XP_063130318 ⟸ XM_063274248
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063130319 ⟸ XM_063274249
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZBL3-F1-model_v2	AlphaFold	D3ZBL3	1-315	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699666

Promoter ID:

EPDNEW_R10188

Type:

multiple initiation site

Name:

Ngdn_1

Description:

neuroguidin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	33,677,635 - 33,677,695	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310211	AgrOrtholog
BioCyc Gene	G2FUF-13744	BioCyc
Ensembl Genes	ENSRNOG00000018069	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024337.5	UniProtKB/TrEMBL
	ENSRNOT00000094340.1	UniProtKB/TrEMBL
	ENSRNOT00000117348.1	UniProtKB/TrEMBL
InterPro	Sas10/Utp3/C1D	UniProtKB/TrEMBL
KEGG Report	rno:305887	UniProtKB/TrEMBL
NCBI Gene	305887	ENTREZGENE
PANTHER	NEUROGUIDIN	UniProtKB/TrEMBL
	PTHR13237	UniProtKB/TrEMBL
Pfam	Sas10_Utp3	UniProtKB/TrEMBL
PhenoGen	Ngdn	PhenoGen
RatGTEx	ENSRNOG00000018069	RatGTEx
UniProt	A0A8I6ALQ0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ATG6_RAT	UniProtKB/TrEMBL
	A6KGY5	ENTREZGENE, UniProtKB/TrEMBL
	D3ZBL3_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Ngdn	neuroguidin	Ngdn	neuroguidin, EIF4E binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-27	Ngdn	neuroguidin, EIF4E binding protein	RGD1310211_predicted	similar to CG11030-PA (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1310211_predicted	similar to CG11030-PA (predicted)	LOC305887_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC305887_predicted	similar to CG11030-PA (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar