Advanced Search (OLGA)

Gene: Nxt1 (nuclear transport factor 2-like export factor 1) Rattus norvegicus

Analyze

Symbol:

Nxt1

Name:

nuclear transport factor 2-like export factor 1

RGD ID:

1309327

Description:

Predicted to enable small GTPase binding activity. Predicted to be involved in poly(A)+ mRNA export from nucleus. Predicted to act upstream of or within RNA export from nucleus and protein export from nucleus. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of nuclear RNA export factor complex and nuclear pore central transport channel. Orthologous to human NXT1 (nuclear transport factor 2 like export factor 1); PARTICIPATES IN NXF1-NXT1 export pathway; influenza A pathway; mRNA decay pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC296219; NTF2-like export factor 1; NTF2-related export protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	156,562,121 - 156,565,043 (+)	NCBI		GRCr8
mRatBN7.2	3	136,108,975 - 136,111,897 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	136,108,862 - 136,111,907 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	140,060,861 - 140,063,991 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	148,645,009 - 148,648,139 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	146,334,588 - 146,337,508 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	142,993,658 - 142,996,580 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	142,993,658 - 142,996,578 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	149,404,217 - 149,407,139 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	137,404,957 - 137,407,879 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	137,310,467 - 137,313,449 (+)	NCBI
Celera	3	134,952,038 - 134,954,960 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

familial hyperinsulinemic hypoglycemia 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

C60 fullerene (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

disodium selenite (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

methimazole (EXP)

methylparaben (ISO)

nickel atom (ISO)

nitrates (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

topotecan (EXP)

triadimefon (EXP)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mRNA export from nucleus (ISO)

poly(A)+ mRNA export from nucleus (IBA)

protein export from nucleus (ISO)

RNA export from nucleus (ISO)

Cellular Component

cytosol (IEA,ISO)

nuclear pore (ISO)

nuclear pore central transport channel (IBA)

nuclear RNA export factor complex (ISO)

nucleoplasm (IEA,ISO)

nucleus (ISO)

Molecular Function

protein binding (ISO)

small GTPase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

influenza A pathway (IEA)

mRNA decay pathway (IEA)

NXF1-NXT1 export pathway (ISO)

ribosome biogenesis pathway (IEA)

RNA transport pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Postage for the messenger: designating routes for nuclear mRNA export.	Natalizio BJ and Wente SR, Trends Cell Biol. 2013 Aug;23(8):365-73. doi: 10.1016/j.tcb.2013.03.006. Epub 2013 Apr 11.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10567585	PMID:11579093	PMID:12477932	PMID:35219094

Genomics

Comparative Map Data

Nxt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	156,562,121 - 156,565,043 (+)	NCBI		GRCr8
mRatBN7.2	3	136,108,975 - 136,111,897 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	136,108,862 - 136,111,907 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	140,060,861 - 140,063,991 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	148,645,009 - 148,648,139 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	146,334,588 - 146,337,508 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	142,993,658 - 142,996,580 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	142,993,658 - 142,996,578 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	149,404,217 - 149,407,139 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	137,404,957 - 137,407,879 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	137,310,467 - 137,313,449 (+)	NCBI
Celera	3	134,952,038 - 134,954,960 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

NXT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	23,350,791 - 23,354,771 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	23,350,791 - 23,354,771 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	23,331,428 - 23,335,408 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	23,279,373 - 23,283,408 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	23,279,372 - 23,283,408	NCBI
Celera	20	23,404,748 - 23,408,783 (+)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	23,292,698 - 23,296,733 (+)	NCBI		HuRef
CHM1_1	20	23,331,839 - 23,335,874 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	23,410,333 - 23,414,313 (+)	NCBI		T2T-CHM13v2.0

Nxt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	148,514,535 - 148,517,946 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	148,514,521 - 148,517,947 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	148,672,615 - 148,676,026 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	148,672,601 - 148,676,027 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	148,498,351 - 148,501,762 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	148,364,083 - 148,367,464 (+)	NCBI		MGSCv36	mm8
Celera	2	149,940,706 - 149,944,117 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	73.53	NCBI

Nxt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	30,366,993 - 30,369,688 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	30,366,993 - 30,369,688 (+)	NCBI	ChiLan1.0	ChiLan1.0

NXT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	24,216,690 - 24,227,958 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	24,215,445 - 24,224,791 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	23,292,400 - 23,296,427 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	23,643,785 - 23,647,856 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	23,647,127 - 23,647,549 (+)	Ensembl	panpan1.1		panPan2

NXT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	295,064 - 299,316 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	316,792 - 320,578 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	687,393 - 691,169 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	24	289,661 - 293,447 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	389,052 - 392,833 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	672,963 - 676,752 (-)	NCBI		UU_Cfam_GSD_1.0

Nxt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	148,822,722 - 148,825,799 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936620	2,243,210 - 2,246,119 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936620	2,243,181 - 2,246,244 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NXT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	30,338,391 - 30,341,628 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	30,338,379 - 30,341,629 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	34,427,323 - 34,430,564 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NXT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	52,357,189 - 52,361,222 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	52,360,491 - 52,360,913 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	7,173,093 - 7,177,137 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nxt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	23,021,076 - 23,023,416 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	23,021,247 - 23,023,327 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nxt1
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	33
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000006205
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

AA891920

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	136,111,498 - 136,111,707 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	142,996,182 - 142,996,390	NCBI	Rnor6.0
Rnor_5.0	3	149,406,741 - 149,406,949	UniSTS	Rnor5.0
RGSC_v3.4	3	137,407,481 - 137,407,689	UniSTS	RGSC3.4
Celera	3	134,954,562 - 134,954,770	UniSTS
RH 3.4 Map	3	1094.41	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC167042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006205 ⟹ ENSRNOP00000006205

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	136,108,862 - 136,111,907 (+)	Ensembl
Rnor_6.0 Ensembl	3	142,993,658 - 142,996,578 (+)	Ensembl

RefSeq Acc Id:

NM_001106521 ⟹ NP_001099991

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	156,562,121 - 156,565,043 (+)	NCBI
mRatBN7.2	3	136,108,975 - 136,111,897 (+)	NCBI
Rnor_6.0	3	142,993,658 - 142,996,580 (+)	NCBI
Rnor_5.0	3	149,404,217 - 149,407,139 (+)	NCBI
RGSC_v3.4	3	137,404,957 - 137,407,879 (+)	RGD
Celera	3	134,952,038 - 134,954,960 (+)	RGD

Sequence:

show sequence

CTAGGAGGAAGAGGAGAACAAGAGAGAAACTCTTCTGGCCCGGGACCGCGGCCCGGGCGGGACC
CGGGGCCGAGTCGCCTAGGCGACGTTGACCGAGACCGAGCAGTCACTGGATCCCTAAGGAGGCG
GCATTCTGGCAGAGGCCTCTGGCAGCAGACCCAGAGATGGCATCAGTAGATTTCAAGACCTATG
TGGACCAGGCCTGCAGAGCTGCAGAGGAATTTGTCAACGTCTACTACACTACTATGGATAATCG
GCGGCGGCTGCTGTCTCGCCTGTACATGGGCACGGCCACTTTAGTATGGAATGGAAATGCCGTT
TCGGGACAAGAATCCTTGAGTGAGTTTTTTGAGATGTTGCCTTCCAGTGAGTTCCAAATCAACG
TGGTAGACTGCCAGCCTGTTCATGATGAAGCTACGCCAAGCCAGACCACGGTCCTTGTGGTCAT
CTGTGGAACAGTGAAATTTGAGGGCAACAAACAGCGGGACTTCAACCAGAACTTCATCCTGACT
GCTCAGGCGTCACCCAGTAACACAGTGTGGAAGATAGCGAGTGACTGCTTCCGCTTCCAGGACT
GGGCCAGCTAGTGGGGGTGACAAAGGCAGCTTGGCTTTAGCCAAGCTCTGCAGAGAAATGCCAG
TCTCAAATCTCAGGACGTGGAGAACACTAGTTCATTTTTGTTGTCACAGCAGCACTGCAAACTG
GATGTTCGACTCCTAGAAACCCCTTTCCTGGTTATATACTGGTTTGTCATAGTTGCCTTTTAAA
AGTAGTAAACTTTCTATTTTTCTACTTACTCAGTAGAGAACCTGTTTCTGGAAATTGACAAATA
AATATGCTGCTTCTCTGCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099991	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67042	(Get FASTA)	NCBI Sequence Viewer
	EDL95097	(Get FASTA)	NCBI Sequence Viewer
	EDL95098	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006205.4

RefSeq Acc Id:	NP_001099991 ⟸ NM_001106521
- UniProtKB:	F7EK82 (UniProtKB/TrEMBL), B2RZ65 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASVDFKTYVDQACRAAEEFVNVYYTTMDNRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEM LPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQASPSNTVWKI ASDCFRFQDWAS hide sequence

Ensembl Acc Id:

ENSRNOP00000006205 ⟸ ENSRNOT00000006205

Protein Domains

NTF2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZ65-F1-model_v2	AlphaFold	B2RZ65	1-140	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692496

Promoter ID:

EPDNEW_R3021

Type:

initiation region

Name:

Nxt1_1

Description:

nuclear transport factor 2-like export factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	142,993,643 - 142,993,703	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309327	AgrOrtholog
BioCyc Gene	G2FUF-47500	BioCyc
Ensembl Genes	ENSRNOG00000004700	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006205.8	UniProtKB/TrEMBL
Gene3D-CATH	3.10.450.50	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7444530	IMAGE-MGC_LOAD
InterPro	NTF2	UniProtKB/TrEMBL
	NTF2-like_dom	UniProtKB/TrEMBL
	NTF2/Mtr2	UniProtKB/TrEMBL
	Nuclear_transport_factor_2_euk	UniProtKB/TrEMBL
KEGG Report	rno:296219	UniProtKB/TrEMBL
MGC_CLONE	MGC:189309	IMAGE-MGC_LOAD
NCBI Gene	296219	ENTREZGENE
PANTHER	PTHR12612	UniProtKB/TrEMBL
Pfam	NTF2	UniProtKB/TrEMBL
PhenoGen	Nxt1	PhenoGen
PROSITE	NTF2_DOMAIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004700	RatGTEx
Superfamily-SCOP	SSF54427	UniProtKB/TrEMBL
UniProt	B2RZ65	ENTREZGENE, UniProtKB/TrEMBL
	F7EK82	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-05-21	Nxt1	nuclear transport factor 2-like export factor 1	Nxt1	NTF2-like export factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Nxt1	NTF2-like export factor 1	Nxt1	NTF2-related export protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Nxt1	NTF2-related export protein 1	Nxt1_predicted	NTF2-related export protein 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Nxt1_predicted	NTF2-related export protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)