Symbol:
Ralgapa2
Name:
Ral GTPase activating protein catalytic subunit alpha 2
RGD ID:
1308023
Description:
Enables GTPase activator activity and protein heterodimerization activity. Involved in activation of GTPase activity. Predicted to be located in cytosol and plasma membrane. Predicted to be active in cytoplasm. Orthologous to human RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
250 kDa substrate of Akt; AS250; LOC296211; p220; Ral GTPase activating protein catalytic alpha subunit 2; Ral GTPase activating protein, alpha subunit 2 (catalytic); Ral GTPase-activating protein alpha subunit 2; ral GTPase-activating protein subunit alpha-2; RGD1308023; similar to CG5521-PA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ralgapa2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ralgapa2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ralgapa2 (Ral GTPase activating protein catalytic subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic))
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RALGAPA2 (Ral GTPase activating protein catalytic subunit alpha 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic))
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hgap-1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5521
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ralgapa2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 154,112,005 - 154,392,070 (-) NCBI GRCr8 mRatBN7.2 3 133,658,725 - 133,938,821 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 133,659,761 - 133,938,916 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 3 140,451,850 - 140,728,305 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 140,468,701 - 140,728,129 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 146,870,901 - 147,146,723 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 134,867,846 - 135,145,583 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 134,893,509 - 134,996,492 (-) NCBI Celera 3 132,526,330 - 132,803,310 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ralgapa2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1343955 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RALGAPA2 mRNA CTD PMID:22079256 Ralgapa2 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1317552 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RALGAPA2 mRNA CTD PMID:36331819 Ralgapa2 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1317552 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Ralgapa2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1317552 6480464 1,2-Dimethylhydrazine results in decreased expression of RALGAPA2 mRNA CTD PMID:22206623 Ralgapa2 Rat 17beta-estradiol multiple interactions ISO RGD:1343955 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of RALGAPA2 mRNA CTD PMID:30165855 Ralgapa2 Rat 17beta-estradiol decreases expression ISO RGD:1317552 6480464 Estradiol results in decreased expression of RALGAPA2 mRNA CTD PMID:39298647 Ralgapa2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of RALGAPA2 mRNA CTD PMID:32145629 Ralgapa2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1317552 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Ralgapa2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1317552 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Ralgapa2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1343955 6480464 Tetrachlorodibenzodioxin results in increased expression of RALGAPA2 mRNA CTD PMID:26238291 Ralgapa2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RALGAPA2 mRNA CTD PMID:33387578 Ralgapa2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of RALGAPA2 mRNA CTD PMID:32109520 Ralgapa2 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1317552 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Ralgapa2 Rat 2,5-hexanedione increases expression EXP 6480464 2,5-hexanedione results in increased expression of RALGAPA2 mRNA CTD PMID:22952946 Ralgapa2 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1343955 6480464 Lactic Acid results in decreased expression of RALGAPA2 mRNA CTD PMID:30851411 Ralgapa2 Rat 3-methylcholanthrene multiple interactions ISO RGD:1343955 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to RALGAPA2 promoter] CTD PMID:20348232 Ralgapa2 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1317552 6480464 bisphenol S results in decreased expression of RALGAPA2 mRNA CTD PMID:39298647 Ralgapa2 Rat aflatoxin B1 increases methylation ISO RGD:1343955 6480464 Aflatoxin B1 results in increased methylation of RALGAPA2 gene CTD PMID:28458013 Ralgapa2 Rat aflatoxin B1 decreases methylation ISO RGD:1343955 6480464 Aflatoxin B1 results in decreased methylation of RALGAPA2 gene CTD PMID:27153756 Ralgapa2 Rat antirheumatic drug increases expression ISO RGD:1343955 6480464 Antirheumatic Agents results in increased expression of RALGAPA2 mRNA CTD PMID:24449571 Ralgapa2 Rat aristolochic acid A decreases expression ISO RGD:1343955 6480464 aristolochic acid I results in decreased expression of RALGAPA2 mRNA CTD PMID:33212167 Ralgapa2 Rat arsane affects methylation ISO RGD:1343955 6480464 Arsenic affects the methylation of RALGAPA2 gene CTD PMID:25304211 Ralgapa2 Rat arsane multiple interactions ISO RGD:1343955 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RALGAPA2 more ... CTD PMID:39836092 Ralgapa2 Rat arsenic atom affects methylation ISO RGD:1343955 6480464 Arsenic affects the methylation of RALGAPA2 gene CTD PMID:25304211 Ralgapa2 Rat arsenic atom multiple interactions ISO RGD:1343955 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RALGAPA2 more ... CTD PMID:39836092 Ralgapa2 Rat benzo[a]pyrene increases expression ISO RGD:1343955 6480464 Benzo(a)pyrene results in increased expression of RALGAPA2 mRNA CTD PMID:26238291 Ralgapa2 Rat benzo[a]pyrene decreases expression ISO RGD:1343955 6480464 Benzo(a)pyrene results in decreased expression of RALGAPA2 mRNA CTD PMID:32234424 Ralgapa2 Rat benzo[a]pyrene decreases methylation ISO RGD:1317552 6480464 Benzo(a)pyrene results in decreased methylation of RALGAPA2 3' UTR; Benzo(a)pyrene results in decreased methylation of more ... CTD PMID:27901495 Ralgapa2 Rat benzo[a]pyrene affects methylation ISO RGD:1343955 6480464 Benzo(a)pyrene affects the methylation of RALGAPA2 intron; Benzo(a)pyrene affects the methylation of RALGAPA2 promoter CTD PMID:27901495|PMID:30157460 Ralgapa2 Rat benzo[a]pyrene increases methylation ISO RGD:1317552 6480464 Benzo(a)pyrene results in increased methylation of RALGAPA2 intron CTD PMID:27901495 Ralgapa2 Rat benzo[b]fluoranthene increases expression ISO RGD:1317552 6480464 benzo(b)fluoranthene results in increased expression of RALGAPA2 mRNA CTD PMID:26377693 Ralgapa2 Rat benzo[e]pyrene increases methylation ISO RGD:1343955 6480464 benzo(e)pyrene results in increased methylation of RALGAPA2 intron CTD PMID:30157460 Ralgapa2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RALGAPA2 mRNA CTD PMID:25181051 Ralgapa2 Rat bisphenol A increases expression ISO RGD:1343955 6480464 bisphenol A results in increased expression of RALGAPA2 mRNA CTD PMID:29275510 Ralgapa2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RALGAPA2 mRNA CTD PMID:30816183|PMID:32145629 Ralgapa2 Rat caffeine affects phosphorylation ISO RGD:1343955 6480464 Caffeine affects the phosphorylation of RALGAPA2 protein CTD PMID:35688186 Ralgapa2 Rat calcitriol increases expression ISO RGD:1343955 6480464 Calcitriol results in increased expression of RALGAPA2 mRNA CTD PMID:21592394 Ralgapa2 Rat calcitriol multiple interactions ISO RGD:1343955 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of RALGAPA2 mRNA CTD PMID:21592394 Ralgapa2 Rat chlorpyrifos decreases expression ISO RGD:1317552 6480464 Chlorpyrifos results in decreased expression of RALGAPA2 mRNA CTD PMID:37019170 Ralgapa2 Rat cisplatin decreases expression ISO RGD:1343955 6480464 Cisplatin results in decreased expression of RALGAPA2 mRNA CTD PMID:27594783 Ralgapa2 Rat Dibutyl phosphate affects expression ISO RGD:1343955 6480464 di-n-butylphosphoric acid affects the expression of RALGAPA2 mRNA CTD PMID:37042841 Ralgapa2 Rat dichloroacetic acid increases expression ISO RGD:1317552 6480464 Dichloroacetic Acid results in increased expression of RALGAPA2 mRNA CTD PMID:28962523 Ralgapa2 Rat dicrotophos increases expression ISO RGD:1343955 6480464 dicrotophos results in increased expression of RALGAPA2 mRNA CTD PMID:28302478 Ralgapa2 Rat doxorubicin decreases expression ISO RGD:1343955 6480464 Doxorubicin results in decreased expression of RALGAPA2 mRNA CTD PMID:29803840 Ralgapa2 Rat entinostat decreases expression ISO RGD:1343955 6480464 entinostat results in decreased expression of RALGAPA2 mRNA CTD PMID:27188386 Ralgapa2 Rat epoxiconazole decreases expression ISO RGD:1317552 6480464 epoxiconazole results in decreased expression of RALGAPA2 mRNA CTD PMID:35436446 Ralgapa2 Rat FR900359 affects phosphorylation ISO RGD:1343955 6480464 FR900359 affects the phosphorylation of RALGAPA2 protein CTD PMID:37730182 Ralgapa2 Rat hexadecanoic acid decreases phosphorylation ISO RGD:1343955 6480464 Palmitic Acid results in decreased phosphorylation of RALGAPA2 protein CTD PMID:28073184 Ralgapa2 Rat leflunomide increases expression ISO RGD:1343955 6480464 leflunomide results in increased expression of RALGAPA2 mRNA CTD PMID:28988120 Ralgapa2 Rat methamphetamine increases methylation ISO RGD:1317552 6480464 Methamphetamine results in increased methylation of RALGAPA2 promoter CTD PMID:26307267 Ralgapa2 Rat methapyrilene increases methylation ISO RGD:1343955 6480464 Methapyrilene results in increased methylation of RALGAPA2 intron CTD PMID:30157460 Ralgapa2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of RALGAPA2 gene CTD PMID:35440735 Ralgapa2 Rat methyl methanesulfonate increases expression ISO RGD:1343955 6480464 Methyl Methanesulfonate results in increased expression of RALGAPA2 mRNA CTD PMID:23649840 Ralgapa2 Rat methylmercury chloride increases expression ISO RGD:1343955 6480464 methylmercuric chloride results in increased expression of RALGAPA2 mRNA CTD PMID:23179753 Ralgapa2 Rat methylmercury chloride decreases expression ISO RGD:1343955 6480464 methylmercuric chloride results in decreased expression of RALGAPA2 mRNA CTD PMID:26272509|PMID:28001369 Ralgapa2 Rat Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of RALGAPA2 mRNA CTD PMID:29162477 Ralgapa2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of RALGAPA2 gene CTD PMID:33148267 Ralgapa2 Rat nickel sulfate decreases expression ISO RGD:1343955 6480464 nickel sulfate results in decreased expression of RALGAPA2 mRNA CTD PMID:22714537 Ralgapa2 Rat ozone multiple interactions ISO RGD:1343955 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of RALGAPA2 mRNA CTD PMID:35430440 Ralgapa2 Rat paracetamol decreases expression ISO RGD:1343955 6480464 Acetaminophen results in decreased expression of RALGAPA2 mRNA CTD PMID:21420995 Ralgapa2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RALGAPA2 mRNA CTD PMID:33387578 Ralgapa2 Rat PCB138 multiple interactions ISO RGD:1317552 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Ralgapa2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1317552 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RALGAPA2 mRNA CTD PMID:36331819 Ralgapa2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of RALGAPA2 gene CTD PMID:33148267 Ralgapa2 Rat potassium chromate decreases expression ISO RGD:1343955 6480464 potassium chromate(VI) results in decreased expression of RALGAPA2 mRNA CTD PMID:22079256 Ralgapa2 Rat potassium chromate multiple interactions ISO RGD:1343955 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RALGAPA2 mRNA CTD PMID:22079256 Ralgapa2 Rat propanal increases expression ISO RGD:1343955 6480464 propionaldehyde results in increased expression of RALGAPA2 mRNA CTD PMID:26079696 Ralgapa2 Rat propiconazole decreases expression ISO RGD:1317552 6480464 propiconazole results in decreased expression of RALGAPA2 mRNA CTD PMID:21278054 Ralgapa2 Rat rac-lactic acid decreases expression ISO RGD:1343955 6480464 Lactic Acid results in decreased expression of RALGAPA2 mRNA CTD PMID:30851411 Ralgapa2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of RALGAPA2 mRNA CTD PMID:28374803 Ralgapa2 Rat sodium arsenite decreases expression ISO RGD:1343955 6480464 sodium arsenite results in decreased expression of RALGAPA2 mRNA CTD PMID:22714537 Ralgapa2 Rat sodium arsenite multiple interactions ISO RGD:1343955 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RALGAPA2 more ... CTD PMID:39836092 Ralgapa2 Rat sunitinib increases expression ISO RGD:1343955 6480464 Sunitinib results in increased expression of RALGAPA2 mRNA CTD PMID:31533062 Ralgapa2 Rat testosterone multiple interactions ISO RGD:1343955 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of RALGAPA2 mRNA CTD PMID:21592394 Ralgapa2 Rat testosterone increases expression ISO RGD:1343955 6480464 Testosterone results in increased expression of RALGAPA2 mRNA CTD PMID:21592394 Ralgapa2 Rat tetrachloroethene increases expression ISO RGD:1317552 6480464 Tetrachloroethylene results in increased expression of RALGAPA2 mRNA CTD PMID:28973375 Ralgapa2 Rat tetraphene increases expression ISO RGD:1317552 6480464 benz(a)anthracene results in increased expression of RALGAPA2 mRNA CTD PMID:26377693 Ralgapa2 Rat thimerosal increases expression ISO RGD:1343955 6480464 Thimerosal results in increased expression of RALGAPA2 mRNA CTD PMID:27188386 Ralgapa2 Rat titanium dioxide decreases expression ISO RGD:1317552 6480464 titanium dioxide results in decreased expression of RALGAPA2 mRNA CTD PMID:35295148 Ralgapa2 Rat triphenyl phosphate affects expression ISO RGD:1343955 6480464 triphenyl phosphate affects the expression of RALGAPA2 mRNA CTD PMID:37042841 Ralgapa2 Rat triptonide decreases expression ISO RGD:1317552 6480464 triptonide results in decreased expression of RALGAPA2 mRNA CTD PMID:33045310 Ralgapa2 Rat troglitazone decreases expression ISO RGD:1317552 6480464 troglitazone results in decreased expression of RALGAPA2 mRNA CTD PMID:28973697 Ralgapa2 Rat trovafloxacin decreases expression ISO RGD:1317552 6480464 trovafloxacin results in decreased expression of RALGAPA2 mRNA CTD PMID:35537566 Ralgapa2 Rat urethane increases expression ISO RGD:1343955 6480464 Urethane results in increased expression of RALGAPA2 mRNA CTD PMID:28818685 Ralgapa2 Rat valproic acid increases expression ISO RGD:1343955 6480464 Valproic Acid results in increased expression of RALGAPA2 mRNA CTD PMID:24383497|PMID:28001369 Ralgapa2 Rat valproic acid affects expression ISO RGD:1343955 6480464 Valproic Acid affects the expression of RALGAPA2 mRNA CTD PMID:23179753 Ralgapa2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of RALGAPA2 mRNA CTD PMID:23034163
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,4'-trichlorobiphenyl (ISO) 2,5-hexanedione (EXP) 2-hydroxypropanoic acid (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) caffeine (ISO) calcitriol (ISO) chlorpyrifos (ISO) cisplatin (ISO) Dibutyl phosphate (ISO) dichloroacetic acid (ISO) dicrotophos (ISO) doxorubicin (ISO) entinostat (ISO) epoxiconazole (ISO) FR900359 (ISO) hexadecanoic acid (ISO) leflunomide (ISO) methamphetamine (ISO) methapyrilene (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) Monobutylphthalate (EXP) N,N-diethyl-m-toluamide (EXP) nickel sulfate (ISO) ozone (ISO) paracetamol (EXP,ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) potassium chromate (ISO) propanal (ISO) propiconazole (ISO) rac-lactic acid (ISO) rotenone (EXP) sodium arsenite (ISO) sunitinib (ISO) testosterone (ISO) tetrachloroethene (ISO) tetraphene (ISO) thimerosal (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Ralgapa2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 154,112,005 - 154,392,070 (-) NCBI GRCr8 mRatBN7.2 3 133,658,725 - 133,938,821 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 133,659,761 - 133,938,916 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 3 140,451,850 - 140,728,305 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 140,468,701 - 140,728,129 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 146,870,901 - 147,146,723 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 134,867,846 - 135,145,583 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 134,893,509 - 134,996,492 (-) NCBI Celera 3 132,526,330 - 132,803,310 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
RALGAPA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 20,389,530 - 20,712,644 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 20,389,530 - 20,712,644 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 20,370,174 - 20,693,287 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 20,321,411 - 20,641,266 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 20 20,447,485 - 20,767,346 (-) NCBI Celera Cytogenetic Map 20 p11.23 NCBI HuRef 20 20,333,630 - 20,656,842 (-) NCBI HuRef CHM1_1 20 20,370,712 - 20,693,651 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 20,448,061 - 20,771,350 (-) NCBI T2T-CHM13v2.0
Ralgapa2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 146,079,326 - 146,354,174 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 146,081,799 - 146,354,264 (-) Ensembl GRCm39 Ensembl GRCm38 2 146,239,876 - 146,512,254 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 146,239,879 - 146,512,344 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 146,067,032 - 146,337,740 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 146,120,893 - 146,203,447 (-) NCBI MGSCv36 mm8 Celera 2 147,474,453 - 147,748,942 (-) NCBI Celera Cytogenetic Map 2 G1 NCBI cM Map 2 71.33 NCBI
Ralgapa2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 28,414,386 - 28,663,485 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 28,414,856 - 28,663,485 (-) NCBI ChiLan1.0 ChiLan1.0
RALGAPA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 21,268,175 - 21,594,631 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 21,267,629 - 21,591,448 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 20,338,629 - 20,662,926 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 20,299,568 - 20,625,458 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 20,299,638 - 20,625,443 (-) Ensembl panpan1.1 panPan2
RALGAPA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 2,665,950 - 2,992,779 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 2,676,461 - 2,989,864 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 2,694,032 - 3,021,021 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 3,073,282 - 3,400,603 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 3,083,818 - 3,398,194 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 2,670,124 - 2,996,986 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 2,773,127 - 3,100,047 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 3,051,017 - 3,378,081 (+) NCBI UU_Cfam_GSD_1.0
Ralgapa2
RALGAPA2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 28,408,099 - 28,679,231 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 28,408,096 - 28,679,231 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 32,010,888 - 32,135,505 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RALGAPA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 49,381,251 - 49,704,946 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 49,465,647 - 49,645,287 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666078 4,168,451 - 4,496,449 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ralgapa2
.
Predicted Target Of
Count of predictions: 16 Count of miRNA genes: 15 Interacting mature miRNAs: 15 Transcripts: ENSRNOT00000015637 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
D3Rat215
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 154,367,513 - 154,367,746 (+) Marker Load Pipeline Rnor_6.0 3 140,703,784 - 140,704,003 NCBI Rnor6.0 Rnor_5.0 3 147,122,482 - 147,122,701 UniSTS Rnor5.0 RGSC_v3.4 3 135,120,846 - 135,121,076 RGD RGSC3.4 RGSC_v3.4 3 135,120,844 - 135,121,076 UniSTS RGSC3.4 RGSC_v3.1 3 135,026,419 - 135,026,649 RGD Celera 3 132,778,800 - 132,779,032 UniSTS SHRSP x BN Map 3 64.1499 RGD SHRSP x BN Map 3 64.1499 UniSTS Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015637 ⟹ ENSRNOP00000015637
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 133,678,482 - 133,938,727 (-) Ensembl Rnor_6.0 Ensembl 3 140,468,701 - 140,728,129 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094218 ⟹ ENSRNOP00000080653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 133,659,761 - 133,938,916 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106826 ⟹ ENSRNOP00000093785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 133,659,761 - 133,938,916 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113019 ⟹ ENSRNOP00000084183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 133,659,761 - 133,938,916 (-) Ensembl
RefSeq Acc Id:
NM_001421313 ⟹ NP_001408242
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,392,047 (-) NCBI mRatBN7.2 3 133,658,725 - 133,938,797 (-) NCBI
RefSeq Acc Id:
XM_017592238 ⟹ XP_017447727
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,392,070 (-) NCBI mRatBN7.2 3 133,661,955 - 133,938,820 (-) NCBI Rnor_6.0 3 140,451,850 - 140,728,305 (-) NCBI
Sequence:
ACCGTTCGGCCCGCCCCTCCTTCCTGGAGCCACCGCTTAAGCTGAGGCGGCGCGGCAGCTAGGAGGGGGGCGGCTAGTGGCCGGAGCGACACGCGCCCGTCGCGACCCTATGCAGTGACTTGTGCGGC
hide sequence
RefSeq Acc Id:
XM_039106622 ⟹ XP_038962550
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,209,810 - 154,392,070 (-) NCBI mRatBN7.2 3 133,756,535 - 133,938,821 (-) NCBI
RefSeq Acc Id:
XM_039106623 ⟹ XP_038962551
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,221,988 - 154,392,069 (-) NCBI mRatBN7.2 3 133,768,709 - 133,938,820 (-) NCBI
RefSeq Acc Id:
XM_039106624 ⟹ XP_038962552
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,221,988 - 154,392,069 (-) NCBI mRatBN7.2 3 133,768,709 - 133,938,820 (-) NCBI
RefSeq Acc Id:
XM_063283347 ⟹ XP_063139417
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,392,070 (-) NCBI
RefSeq Acc Id:
XM_063283348 ⟹ XP_063139418
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,392,069 (-) NCBI
RefSeq Acc Id:
XM_063283349 ⟹ XP_063139419
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,392,069 (-) NCBI
RefSeq Acc Id:
XM_063283350 ⟹ XP_063139420
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,378,785 (-) NCBI
RefSeq Acc Id:
XM_063283352 ⟹ XP_063139422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,292,812 (-) NCBI
RefSeq Acc Id:
XM_063283353 ⟹ XP_063139423
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,112,005 - 154,283,873 (-) NCBI
RefSeq Acc Id:
XR_005502527
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,230,860 - 154,392,069 (-) NCBI mRatBN7.2 3 133,773,811 - 133,938,820 (-) NCBI
RefSeq Acc Id:
XR_005502528
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,221,980 - 154,392,069 (-) NCBI mRatBN7.2 3 133,768,709 - 133,938,820 (-) NCBI
RefSeq Acc Id:
XR_005502529
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,221,980 - 154,392,069 (-) NCBI mRatBN7.2 3 133,768,709 - 133,938,820 (-) NCBI
RefSeq Acc Id:
XR_010064588
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 154,231,124 - 154,392,069 (-) NCBI
RefSeq Acc Id:
XP_017447727 ⟸ XM_017592238
- Peptide Label:
isoform X1
- UniProtKB:
P86411 (UniProtKB/Swiss-Prot)
- Sequence:
MFSRRSHGDVKKSTQKVLDPKKDVLTRLKHLRALLGTHDPQYRGRVRAGHLDNVDASDLKQFFETNYSQIYFIFYENFITLENSLKLKGNNKSQREELDSILFLFEKILQFLPERIFFRWHYQSIGST
hide sequence
Ensembl Acc Id:
ENSRNOP00000015637 ⟸ ENSRNOT00000015637
RefSeq Acc Id:
XP_038962550 ⟸ XM_039106622
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038962552 ⟸ XM_039106624
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038962551 ⟸ XM_039106623
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000093785 ⟸ ENSRNOT00000106826
Ensembl Acc Id:
ENSRNOP00000080653 ⟸ ENSRNOT00000094218
Ensembl Acc Id:
ENSRNOP00000084183 ⟸ ENSRNOT00000113019
RefSeq Acc Id:
NP_001408242 ⟸ NM_001421313
- UniProtKB:
P86411 (UniProtKB/Swiss-Prot), A0A8I6G4U3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139417 ⟸ XM_063283347
- Peptide Label:
isoform X2
- UniProtKB:
P86411 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063139418 ⟸ XM_063283348
- Peptide Label:
isoform X3
- UniProtKB:
P86411 (UniProtKB/Swiss-Prot), A0A8I6AGG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139419 ⟸ XM_063283349
- Peptide Label:
isoform X4
- UniProtKB:
P86411 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063139420 ⟸ XM_063283350
- Peptide Label:
isoform X5
- UniProtKB:
P86411 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063139422 ⟸ XM_063283352
- Peptide Label:
isoform X9
- UniProtKB:
A6K791 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139423 ⟸ XM_063283353
- Peptide Label:
isoform X10
- UniProtKB:
A6K791 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-12-06
Ralgapa2
Ral GTPase activating protein catalytic subunit alpha 2
Ralgapa2
Ral GTPase activating protein catalytic alpha subunit 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-03
Ralgapa2
Ral GTPase activating protein catalytic alpha subunit 2
Ralgapa2
Ral GTPase activating protein, alpha subunit 2 (catalytic)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-10
Ralgapa2
Ral GTPase activating protein, alpha subunit 2 (catalytic)
RGD1308023
similar to CG5521-PA
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1308023
similar to CG5521-PA
RGD1308023_predicted
similar to CG5521-PA (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-20
RGD1308023_predicted
similar to CG5521-PA (predicted)
LOC296211_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC296211_predicted
similar to CG5521-PA (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
