Advanced Search (OLGA)

Gene: Pcid2 (PCI domain containing 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pcid2

Name:

PCI domain containing 2

RGD ID:

1307041

Description:

Predicted to enable RNA binding activity and double-stranded DNA binding activity. Predicted to be involved in several processes, including gene expression; post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery; and regulation of DNA-templated transcription. Predicted to be located in cytoplasm and nucleus. Predicted to be part of nuclear pore nuclear basket and transcription export complex 2. Orthologous to human PCID2 (PCI domain containing 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; hexane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC361182; LOC361182; PCI domain-containing protein 2; RGD1307041; similar to hypothetical protein FLJ11305; uncharacterized protein LOC361182

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PCID2 (PCI domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Pcid2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pcid2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PCID2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PCID2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pcid2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PCID2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PCID2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pcid2 (PCI domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	WDFY3 (WD repeat and FYVE domain containing 3)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pcid2 (PCI domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PCID2 (PCI domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pcid2 (PCI domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C27F2.10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PCID2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	THP1	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YJR084W	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pcid2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	83,125,386 - 83,150,851 (+)	NCBI		GRCr8
mRatBN7.2	16	76,423,245 - 76,448,712 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	76,423,245 - 76,448,712 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	81,703,795 - 81,729,260 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	85,156,372 - 85,181,837 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	80,405,044 - 80,431,334 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	81,757,582 - 81,783,047 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	81,756,971 - 81,783,047 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	81,242,949 - 81,268,414 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	81,280,427 - 81,305,892 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	81,279,932 - 81,305,288 (+)	NCBI
Celera	16	74,229,279 - 74,254,744 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcid2	Rat	blood coagulation disease		ISO	PCID2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Protein Z deficiency	ClinVar
Pcid2	Rat	factor X deficiency		ISO	PCID2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Factor X deficiency	ClinVar	PMID:25741868 and PMID:34355501
Pcid2	Rat	hemorrhagic disease		ISO	PCID2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Abnormal bleeding	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcid2	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PCID2 mRNA	CTD	PMID:22079256
Pcid2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Pcid2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of PCID2 mRNA	CTD	PMID:22206623
Pcid2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	PCID2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of PCID2 mRNA	CTD	PMID:22574217
Pcid2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PCID2 mRNA	CTD	PMID:33387578
Pcid2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Pcid2 (Mus musculus)	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of PCID2 mRNA	CTD	PMID:25975270
Pcid2	Rat	2-hydroxypropanoic acid	increases expression	ISO	PCID2 (Homo sapiens)	6480464	Lactic Acid results in increased expression of PCID2 mRNA	CTD	PMID:30851411
Pcid2	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Pcid2 (Mus musculus)	6480464	bisphenol S results in decreased expression of PCID2 mRNA	CTD	PMID:39298647
Pcid2	Rat	aflatoxin B1	increases expression	ISO	PCID2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of PCID2 mRNA	CTD	PMID:27153756
Pcid2	Rat	all-trans-retinoic acid	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Tretinoin results in decreased expression of PCID2 mRNA	CTD	PMID:33167477
Pcid2	Rat	arsane	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PCID2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PCID2 mRNA	CTD	PMID:39836092
Pcid2	Rat	arsenic atom	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PCID2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PCID2 mRNA	CTD	PMID:39836092
Pcid2	Rat	benzo[a]pyrene	multiple interactions	ISO	Pcid2 (Mus musculus)	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to PCID2 promoter]	CTD	PMID:19654925
Pcid2	Rat	benzo[a]pyrene	increases methylation	ISO	PCID2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of PCID2 3' UTR	CTD	PMID:27901495
Pcid2	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Pcid2 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of PCID2 mRNA	CTD	PMID:34319233
Pcid2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PCID2 mRNA	CTD	PMID:25181051
Pcid2	Rat	bisphenol A	increases expression	ISO	PCID2 (Homo sapiens)	6480464	bisphenol A results in increased expression of PCID2 mRNA	CTD	PMID:33670352
Pcid2	Rat	butan-1-ol	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of PCID2 mRNA	CTD	PMID:29432896
Pcid2	Rat	cannabidiol	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Cannabidiol results in decreased expression of PCID2 mRNA	CTD	PMID:27918106
Pcid2	Rat	CGP 52608	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to PCID2 gene]	CTD	PMID:28238834
Pcid2	Rat	copper atom	multiple interactions	ISO	Pcid2 (Mus musculus)	6480464	MT1 affects the reaction [Copper results in increased expression of PCID2 mRNA] and MT2 affects the reaction [Copper results in increased expression of PCID2 mRNA]	CTD	PMID:16629173
Pcid2	Rat	copper(0)	multiple interactions	ISO	Pcid2 (Mus musculus)	6480464	MT1 affects the reaction [Copper results in increased expression of PCID2 mRNA] and MT2 affects the reaction [Copper results in increased expression of PCID2 mRNA]	CTD	PMID:16629173
Pcid2	Rat	Dibutyl phosphate	affects expression	ISO	PCID2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of PCID2 mRNA	CTD	PMID:37042841
Pcid2	Rat	dicrotophos	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	dicrotophos results in decreased expression of PCID2 mRNA	CTD	PMID:28302478
Pcid2	Rat	ethanol	affects splicing	ISO	Pcid2 (Mus musculus)	6480464	Ethanol affects the splicing of PCID2 mRNA	CTD	PMID:30319688
Pcid2	Rat	folic acid	decreases expression	ISO	Pcid2 (Mus musculus)	6480464	Folic Acid results in decreased expression of PCID2 mRNA	CTD	PMID:25629700
Pcid2	Rat	formaldehyde	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of PCID2 mRNA	CTD	PMID:23649840
Pcid2	Rat	hexane	decreases methylation	EXP		6480464	n-hexane results in decreased methylation of PCID2 promoter	CTD	PMID:23740543
Pcid2	Rat	ivermectin	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Ivermectin results in decreased expression of PCID2 protein	CTD	PMID:32959892
Pcid2	Rat	manganese atom	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PCID2 mRNA	CTD	PMID:39836092
Pcid2	Rat	manganese(0)	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PCID2 mRNA	CTD	PMID:39836092
Pcid2	Rat	manganese(II) chloride	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PCID2 mRNA	CTD	PMID:39836092
Pcid2	Rat	methyl methanesulfonate	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of PCID2 mRNA	CTD	PMID:23649840
Pcid2	Rat	ozone	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of PCID2 mRNA	CTD	PMID:35430440
Pcid2	Rat	paracetamol	increases expression	ISO	PCID2 (Homo sapiens)	6480464	Acetaminophen results in increased expression of PCID2 mRNA	CTD	PMID:22230336
Pcid2	Rat	potassium chromate	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of PCID2 mRNA	CTD	PMID:22079256
Pcid2	Rat	potassium chromate	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PCID2 mRNA	CTD	PMID:22079256
Pcid2	Rat	rac-lactic acid	increases expression	ISO	PCID2 (Homo sapiens)	6480464	Lactic Acid results in increased expression of PCID2 mRNA	CTD	PMID:30851411
Pcid2	Rat	resveratrol	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of PCID2 mRNA	CTD	PMID:23557933
Pcid2	Rat	silicon dioxide	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Silicon Dioxide results in decreased expression of PCID2 mRNA	CTD	PMID:25351596
Pcid2	Rat	sodium arsenite	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of PCID2 mRNA	CTD	PMID:38568856
Pcid2	Rat	sodium arsenite	multiple interactions	ISO	PCID2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PCID2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PCID2 mRNA	CTD	PMID:39836092
Pcid2	Rat	temozolomide	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Temozolomide results in decreased expression of PCID2 mRNA	CTD	PMID:31758290
Pcid2	Rat	tert-butyl hydroperoxide	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of PCID2 mRNA	CTD	PMID:15336504
Pcid2	Rat	titanium dioxide	decreases methylation	ISO	Pcid2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PCID2 gene	CTD	PMID:35295148
Pcid2	Rat	trimellitic anhydride	increases expression	ISO	Pcid2 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of PCID2 mRNA	CTD	PMID:19042947
Pcid2	Rat	triphenyl phosphate	affects expression	ISO	PCID2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PCID2 mRNA	CTD	PMID:37042841
Pcid2	Rat	urethane	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Urethane results in decreased expression of PCID2 mRNA	CTD	PMID:28818685
Pcid2	Rat	valproic acid	decreases methylation	ISO	PCID2 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of PCID2 gene	CTD	PMID:29154799
Pcid2	Rat	valproic acid	decreases expression	ISO	PCID2 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PCID2 mRNA	CTD	PMID:23179753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcid2	Rat	negative regulation of gene expression, epigenetic	involved_in	ISO	Pcid2 (Mus musculus)	1624291	PMID:29138493	RGD	PMID:29138493
Pcid2	Rat	negative regulation of lymphoid progenitor cell differentiation	involved_in	ISO	Pcid2 (Mus musculus)	1624291	PMID:29138493	RGD	PMID:29138493
Pcid2	Rat	poly(A)+ mRNA export from nucleus	involved_in	ISO	PCID2 (Homo sapiens)	1624291	PMID:20870947	RGD	PMID:20870947
Pcid2	Rat	poly(A)+ mRNA export from nucleus	involved_in	IBA	PANTHER:PTN000296424 and TAIR:locus:2050414	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pcid2	Rat	positive regulation of B cell differentiation	involved_in	ISO	Pcid2 (Mus musculus)	1624291	PMID:20870947	RGD	PMID:20870947
Pcid2	Rat	post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery	involved_in	IBA	PANTHER:PTN000296424 and SGD:S000005433	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pcid2	Rat	spleen development	involved_in	ISO	Pcid2 (Mus musculus)	1624291	PMID:20870947	RGD	PMID:20870947
Pcid2	Rat	transcription elongation by RNA polymerase II	involved_in	IBA	PANTHER:PTN000296424 and SGD:S000005433	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcid2	Rat	cytoplasm	located_in	ISO	PCID2 (Homo sapiens)	1624291	PMID:23591820	RGD	PMID:23591820
Pcid2	Rat	nuclear pore nuclear basket	part_of	ISO	PCID2 (Homo sapiens)	1624291	PMID:23591820	RGD	PMID:23591820
Pcid2	Rat	nucleus	located_in	ISO	PCID2 (Homo sapiens)	1624291	PMID:23591820	RGD	PMID:23591820
Pcid2	Rat	transcription export complex 2	part_of	ISO	PCID2 (Homo sapiens)	1624291	PMID:23591820	RGD	PMID:23591820
Pcid2	Rat	transcription export complex 2	part_of	IBA	FB:FBgn0036184 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcid2	Rat	double-stranded DNA binding	enables	IBA	PANTHER:PTN000296424 and SGD:S000005433	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pcid2	Rat	double-stranded DNA binding	enables	IEA	InterPro:IPR045114	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pcid2	Rat	protein binding	enables	ISO	PCID2 (Homo sapiens)	1624291	UniProtKB:O15182 more ...	RGD	PMID:23591820 more ...
Pcid2	Rat	protein binding	enables	ISO	Pcid2 (Mus musculus)	1624291	UniProtKB:Q8R331 and PMID:29138493	RGD	PMID:29138493
Pcid2	Rat	protein binding	enables	ISO	PCID2 (Homo sapiens) and UniProtKB:Q5JVF3-1	1624291	UniProtKB:P60896 and PMID:22343721	RGD	PMID:22343721
Pcid2	Rat	RNA binding	enables	IEA	InterPro:IPR045114	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pcid2	Rat	RNA binding	enables	IBA	PANTHER:PTN000296424 and SGD:S000005433	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:20870947	PMID:23591820

Pcid2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	83,125,386 - 83,150,851 (+)	NCBI		GRCr8
mRatBN7.2	16	76,423,245 - 76,448,712 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	76,423,245 - 76,448,712 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	81,703,795 - 81,729,260 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	85,156,372 - 85,181,837 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	80,405,044 - 80,431,334 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	81,757,582 - 81,783,047 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	81,756,971 - 81,783,047 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	81,242,949 - 81,268,414 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	81,280,427 - 81,305,892 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	81,279,932 - 81,305,288 (+)	NCBI
Celera	16	74,229,279 - 74,254,744 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

PCID2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	113,165,002 - 113,208,669 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	113,177,536 - 113,208,715 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	113,831,850 - 113,862,983 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	112,879,927 - 112,910,984 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	13	94,658,168 - 94,689,275 (-)	NCBI		Celera
Cytogenetic Map	13	q34	NCBI
HuRef	13	94,270,740 - 94,301,913 (-)	NCBI		HuRef
CHM1_1	13	113,800,717 - 113,831,888 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	112,427,103 - 112,461,015 (-)	NCBI		T2T-CHM13v2.0

Pcid2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	13,125,476 - 13,155,343 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	13,127,189 - 13,155,459 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	13,075,476 - 13,105,343 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	13,077,189 - 13,105,459 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	13,077,525 - 13,105,343 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	13,077,167 - 13,105,382 (-)	NCBI		MGSCv36	mm8
Celera	8	13,244,463 - 13,272,258 (-)	NCBI		Celera
Cytogenetic Map	8	A1.1	NCBI
cM Map	8	5.73	NCBI

Pcid2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	618,092 - 639,704 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	618,092 - 639,424 (+)	NCBI	ChiLan1.0	ChiLan1.0

PCID2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	114,681,970 - 114,713,034 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	113,369,041 - 113,400,323 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	94,319,699 - 94,350,763 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	113,388,251 - 113,419,523 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	113,388,251 - 113,419,251 (-)	Ensembl	panpan1.1		panPan2

PCID2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	60,602,440 - 60,623,811 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	60,602,888 - 60,623,719 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	60,314,829 - 60,336,177 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	61,228,565 - 61,250,676 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	61,228,122 - 61,309,216 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	60,726,462 - 60,747,819 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	60,728,651 - 60,750,011 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	60,760,103 - 60,781,453 (-)	NCBI		UU_Cfam_GSD_1.0

Pcid2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	195,488,082 - 195,511,764 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	446,712 - 465,039 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	440,440 - 464,116 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PCID2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	78,541,318 - 78,556,733 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	78,541,278 - 78,556,784 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	86,178,780 - 86,194,261 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PCID2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	91,163,158 - 91,212,450 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	91,177,463 - 91,211,735 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	48,212,929 - 48,249,687 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pcid2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624793	722,762 - 744,743 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624793	722,743 - 744,824 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pcid2
104 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	421
Count of miRNA genes:	242
Interacting mature miRNAs:	282
Transcripts:	ENSRNOT00000044085
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

RH130153

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	76,448,462 - 76,448,676 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	81,782,798 - 81,783,011	NCBI	Rnor6.0
Rnor_5.0	16	81,268,165 - 81,268,378	UniSTS	Rnor5.0
RGSC_v3.4	16	81,305,643 - 81,305,856	UniSTS	RGSC3.4
Celera	16	74,254,495 - 74,254,708	UniSTS
RH 3.4 Map	16	743.1	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

RH133856

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	76,447,495 - 76,447,693 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	81,781,831 - 81,782,028	NCBI	Rnor6.0
Rnor_5.0	16	81,267,198 - 81,267,395	UniSTS	Rnor5.0
RGSC_v3.4	16	81,304,676 - 81,304,873	UniSTS	RGSC3.4
Celera	16	74,253,528 - 74,253,725	UniSTS
RH 3.4 Map	16	742.0	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001169144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160879	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000044085 ⟹ ENSRNOP00000049378

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	76,423,245 - 76,448,712 (+)	Ensembl
Rnor_6.0 Ensembl	16	81,756,971 - 81,783,047 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116016 ⟹ ENSRNOP00000082024

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	76,423,245 - 76,448,712 (+)	Ensembl

RefSeq Acc Id:

NM_001169144 ⟹ NP_001162615

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	83,125,386 - 83,150,851 (+)	NCBI
mRatBN7.2	16	76,423,245 - 76,448,712 (+)	NCBI
Rnor_6.0	16	81,757,582 - 81,783,047 (+)	NCBI
Rnor_5.0	16	81,242,949 - 81,268,414 (+)	NCBI
RGSC_v3.4	16	81,280,427 - 81,305,892 (+)	RGD
Celera	16	74,229,279 - 74,254,744 (+)	RGD

Sequence:

show sequence

CCGCGGCTGCTGCTATGGCGCACATCACCATTAACCAGTACCTGCAGCAGGTATATGAAGCCATTGACACCAGAGATGGAGCGTCCTGTGCAGAGCTGGTGTCCTTCAAGCACCCTCATGTCGCGAAC
CCACGGCTCCAGATGGCCTCTCCAGAAGAGAAATGCCAGCAAGTTTTGGAGCCCCCTTATGACGAAATGTTTGCGGCTCATTTAAGGTGTACCTACGCTGTGGGGAATCACGACTTCATAGAGGCGTA
CAAATGCCAGACAGTGATAGTCCAATCATTCCTTCGGGCTTTCCAGGCTCACAAAGAAGAAAACTGGGCTCTGCCTGTCATGTACGCAGTAGCACTTGACCTCCGCGTGTTTGCCAATAATGCAGATC
AGCAGTTGGTAAAGAAGGGGAAGAGCAAAGTTGGAGACATGCTGGAAAAGGCCGCCGAGCTGCTGATGAGCTGCTTCCGAGTCTGCGCCAGTGACACCCGCGCTGGCATAGAGGACTCTAAGAAGTGG
GGGATGCTGTTCCTGGTGAACCAACTATTTAAAATCTACTTCAAGATCAACAAACTCCATTTGTGTAAACCTCTTATCAGAGCCATCGACAGCTCGAATCTGAAAGATGACTATAGCACGGCACAGAG
GGTCACATACAAGTACTATGTGGGGCGCAAGGCCATGTTTGACAGTGACTTCAAGCAAGCTGAGGAGTACCTGTCGTTTGCCTTTGAGCACTGCCATCGCTCCAGCCAGAAGAACAAGAGGATGATTC
TGATCTACCTGCTGCCAGTGAAGATGCTGCTGGGTCACATGCCGACCATCGAGCTCCTGAGGAAGTACCACCTGATGCAGTTCTCAGAAGTGACCAGAGCTGTCAGTGAGGGCAACCTGCTGCTGCTC
AATGAGGCGCTGGCAAAGCACGAGACTTTCTTCATCCGCTGTGGTATCTTCCTCATCCTGGAGAAGCTGAAGATCATCACTTACAGGAACCTCTTCAAGAAAGTATATTTGCTACTCAAAACACATCA
GCTGTCTCTAGATGCCTTTCTGGTTGCTTTGAAGTTCATGCACGTGGAAGATGTGGACATTGACGAAGTCCAGTGCATTCTGGCCAACTTGATACACATGGGTCACATTAAAGGTTATATCTCCCATC
AGCATCAGAAACTGGTCGTCAGCAAGCAGAACCCTTTCCCTCCGCTGTCCACGGTGTGCTAAGGCCCAGGCCCTGCAGGTGGAGAGCTCCTTTTGCAGCTGTCCTCTGTAGCTCAAGTCTCCGGGGCT
TCCCCAGCCCCCCGAGGCAGCTGCCAGCACCTGAGGGACTCGCCGTGTTCCCATTGTCCTAATCATGCCAGCCTCGCTAAGACCTGGAATTCTTTTTCAGGACGGACAAACAGCCTGCTGCTGGCCTG
TGGTGCCTGTGAACTTCTGGGAGGGAAACAGCTATGCTTCCGTTTTATGTTGTTTATGGAGGCTGTCTTTGTAACACTTTGTAGTGTTTTCTTTCTTTCCTTCTTTCTCTCTTCCTTTTTAAGAACAG
GTAATCCACATTTATACAGCGGGCGGGCGCCTTCTTGTGTGTTAAGTGATGTATCTATTTTCATATGCGAAATGTCAGCCTTTTGTGAGCTCAAAATGCTTAGTTAACTTGAGGCTTCTTTTTAAAAA
GTAGAATTTAGGGGCTGGGGATTTGGCTCAGTGGCAGAGCGCTTGCCTAGGAAGCGCAAGGCCCTGGGTTCGGTCCCCAGCTCCGAAAAAAAGAACAAAAAAAAAAAAAAAAAAGTAGAATTTAGGGG
GTGGAGAGGTGGTTCAGTCAAGACAGCTACTGCTGTGCCAGAGGGGGTGTGTTTGTTTCCTAGCATTCACATGGCAGCTCACAGCCATCTAACTCCAGTTCTAGGAATCCATTGCTTTTGGCCTCCAT
GGGCTCCTGCACATGTATGTACATAAGCTTACTCGGGCAAACGGGCAAATGTAAGCAAATAAGTCTTCTTAAAGAAAAGCAGAATTTAGTCTGATGTAAAATTTTCAGCTCTCTGCTCATTTTCCTAT
GGTTCTGAAGGCTATGGGACTAAGGCAAGGCCTGACTGTTGGGCTCTGGTCAGGGGCCCTTCTGCGCTACTGTTGCTTGTCCTCGGCCTCTCTTCCTTTTCCTACAGCCTCTGTGCTGCCAGGCCCTC
ACTCTGCAGCTATGTCCAGCTTAACCCCTTCCAGAAACTCTGTCTCTAGGCAGTTGGCCTGGACAGGGCTTCAGCAAAAGATTCTGGGCACAAAACATCCTGCAGTGCTGGAGACTGCTGCTGCTTTC
TCCTTCCTCTTCTTCCTCCTCTTCCTCCTCTTCTTTTTAATAAATAGTTTATTTATTTTA

hide sequence

RefSeq Acc Id:

XM_063275578 ⟹ XP_063131648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	83,138,344 - 83,150,851 (+)	NCBI


Protein RefSeqs	NP_001162615	(Get FASTA)	NCBI Sequence Viewer
	XP_063131648	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI60879	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000049378
	ENSRNOP00000049378.3
	ENSRNOP00000082024.1

RefSeq Acc Id:

NP_001162615 ⟸ NM_001169144

- UniProtKB:

B1H263 (UniProtKB/TrEMBL), F1MAF5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVK
KGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLL
PVKMLLGHMPTIELLRKYHLMQFSEVTRAVSEGNLLLLNEALAKHETFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMHVEDVDIDEVQCILANLIHMGHIKGYISHQHQKL
VVSKQNPFPPLSTVC

hide sequence

Ensembl Acc Id:

ENSRNOP00000049378 ⟸ ENSRNOT00000044085

Ensembl Acc Id:

ENSRNOP00000082024 ⟸ ENSRNOT00000116016

RefSeq Acc Id:	XP_063131648 ⟸ XM_063275578
- Peptide Label:	isoform X1

Protein Domains

PCI

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1MAF5-F1-model_v2	AlphaFold	F1MAF5	1-399	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700235

Promoter ID:

EPDNEW_R10758

Type:

multiple initiation site

Name:

Pcid2_1

Description:

PCI domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	81,757,573 - 81,757,633	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-10700	BioCyc
Ensembl Genes	ENSRNOG00000025222	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000044085	ENTREZGENE
	ENSRNOT00000044085.5	UniProtKB/TrEMBL
	ENSRNOT00000116016.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7380467	IMAGE-MGC_LOAD
InterPro	Csn12-like	UniProtKB/TrEMBL
	PCI_dom	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:361182	UniProtKB/TrEMBL
MGC_CLONE	MGC:188281	IMAGE-MGC_LOAD
NCBI Gene	361182	ENTREZGENE
PANTHER	PCI DOMAIN-CONTAINING PROTEIN 2	UniProtKB/TrEMBL
	PTHR12732	UniProtKB/TrEMBL
Pfam	PCI	UniProtKB/TrEMBL
PhenoGen	Pcid2	PhenoGen
PROSITE	PCI	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000025222	RatGTEx
SMART	PAM	UniProtKB/TrEMBL
UniProt	A0A8I5ZTF8_RAT	UniProtKB/TrEMBL
	B1H263	ENTREZGENE, UniProtKB/TrEMBL
	F1MAF5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-10	Pcid2	PCI domain containing 2	RGD1307041	similar to hypothetical protein FLJ11305	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1307041	similar to hypothetical protein FLJ11305	RGD1307041_predicted	similar to hypothetical protein FLJ11305 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1307041_predicted	similar to hypothetical protein FLJ11305 (predicted)	LOC361182_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361182_predicted	similar to hypothetical protein FLJ11305 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar