Ccndbp1 (cyclin D1 binding protein 1)

Advanced Search (OLGA)

Gene: Ccndbp1 (cyclin D1 binding protein 1) Rattus norvegicus

Analyze

Symbol:

Ccndbp1

Name:

cyclin D1 binding protein 1

RGD ID:

1304669

Description:

Predicted to be located in nuclear body. Predicted to be active in nucleus. Orthologous to human CCNDBP1 (cyclin D1 binding protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cyclin D-type binding-protein 1; cyclin-D1-binding protein 1; LOC362201; MGC109078

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCNDBP1 (cyclin D1 binding protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccndbp1 (cyclin D-type binding-protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccndbp1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCNDBP1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCNDBP1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccndbp1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCNDBP1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCNDBP1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccndbp1 (cyclin D1 binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PCDHB1 (protocadherin beta 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CCNDBP1 (cyclin D1 binding protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccndbp1 (cyclin D-type binding-protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccndbp1 (cyclin D-type binding-protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccndbp1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	128,416,105 - 128,427,985 (+)	NCBI		GRCr8
mRatBN7.2	3	107,962,402 - 107,974,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	107,962,261 - 107,974,233 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	111,636,418 - 111,645,876 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	120,231,996 - 120,241,454 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	117,892,400 - 117,901,858 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	112,951,065 - 112,961,620 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	112,950,890 - 112,961,614 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	119,494,005 - 119,504,497 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	107,787,374 - 107,800,798 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	107,683,801 - 107,697,225 (+)	NCBI
Celera	3	106,867,412 - 106,877,409 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

Experimental Liver Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

butanal (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

chrysene (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

dibenzo[a,l]pyrene (ISO)

dicrotophos (ISO)

diuron (EXP)

ethanol (ISO)

folic acid (ISO)

ketamine (EXP)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (ISO)

paracetamol (ISO)

pentanal (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IEA)

nuclear body (IEA,ISO)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12437976

Genomics

Comparative Map Data

Ccndbp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	128,416,105 - 128,427,985 (+)	NCBI		GRCr8
mRatBN7.2	3	107,962,402 - 107,974,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	107,962,261 - 107,974,233 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	111,636,418 - 111,645,876 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	120,231,996 - 120,241,454 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	117,892,400 - 117,901,858 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	112,951,065 - 112,961,620 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	112,950,890 - 112,961,614 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	119,494,005 - 119,504,497 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	107,787,374 - 107,800,798 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	107,683,801 - 107,697,225 (+)	NCBI
Celera	3	106,867,412 - 106,877,409 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

CCNDBP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	43,185,403 - 43,197,177 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	43,185,118 - 43,197,177 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	43,477,601 - 43,489,375 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	41,264,832 - 41,274,688 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	41,265,441 - 41,274,685	NCBI
Celera	15	20,248,291 - 20,259,057 (+)	NCBI		Celera
Cytogenetic Map	15	q15.2	NCBI
HuRef	15	20,326,261 - 20,338,170 (+)	NCBI		HuRef
CHM1_1	15	43,596,288 - 43,608,156 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	40,992,692 - 41,004,466 (+)	NCBI		T2T-CHM13v2.0

Ccndbp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	120,838,925 - 120,847,374 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	120,838,884 - 120,847,385 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	121,008,395 - 121,016,912 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	121,008,403 - 121,016,904 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	120,834,144 - 120,842,648 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	120,699,952 - 120,708,332 (+)	NCBI		MGSCv36	mm8
Celera	2	122,158,019 - 122,166,556 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	60.37	NCBI

Ccndbp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	9,772,823 - 9,782,047 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	9,772,823 - 9,782,047 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCNDBP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	32,436,990 - 32,446,999 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	36,598,772 - 36,608,750 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	22,146,561 - 22,156,570 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	40,301,401 - 40,311,443 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	40,301,401 - 40,311,443 (+)	Ensembl	panpan1.1		panPan2

CCNDBP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	10,053,673 - 10,064,132 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	10,053,013 - 10,119,795 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	10,113,039 - 10,124,449 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	10,190,118 - 10,201,532 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	10,190,133 - 10,257,448 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	10,106,941 - 10,118,340 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	10,227,915 - 10,239,287 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	10,347,662 - 10,359,071 (+)	NCBI		UU_Cfam_GSD_1.0

Ccndbp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	88,517,181 - 88,565,679 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	6,365,344 - 6,375,102 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	6,365,254 - 6,375,426 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCNDBP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	128,253,035 - 128,269,452 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	128,253,111 - 128,269,534 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	143,132,945 - 143,135,608 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCNDBP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	39,794,572 - 39,807,919 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	39,797,083 - 39,807,827 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	101,205,210 - 101,216,523 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccndbp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	10,287,852 - 10,299,652 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	10,287,843 - 10,307,969 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ccndbp1
91 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	30
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000015472
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

RH128774

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,961,394 - 107,961,585 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,949,983 - 112,950,173	NCBI	Rnor6.0
Rnor_5.0	3	119,493,018 - 119,493,208	UniSTS	Rnor5.0
RGSC_v3.4	3	107,786,292 - 107,786,482	UniSTS	RGSC3.4
Celera	3	106,866,330 - 106,866,520	UniSTS
RH 3.4 Map	3	939.9	UniSTS
Cytogenetic Map	3	q35	UniSTS

C77355

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,961,350 - 107,961,580 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,949,939 - 112,950,168	NCBI	Rnor6.0
Rnor_5.0	3	119,492,974 - 119,493,203	UniSTS	Rnor5.0
RGSC_v3.4	3	107,786,248 - 107,786,477	UniSTS	RGSC3.4
Celera	3	106,866,286 - 106,866,515	UniSTS
Cytogenetic Map	3	q35	UniSTS

BE108387

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,973,318 - 107,973,520 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,960,705 - 112,960,906	NCBI	Rnor6.0
Rnor_5.0	3	119,503,582 - 119,503,783	UniSTS	Rnor5.0
RGSC_v3.4	3	107,799,883 - 107,800,084	UniSTS	RGSC3.4
Celera	3	106,876,494 - 106,876,695	UniSTS
RH 3.4 Map	3	938.8	UniSTS
Cytogenetic Map	3	q35	UniSTS

Maid

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	107,973,981 - 107,974,101 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,961,368 - 112,961,487	NCBI	Rnor6.0
Rnor_5.0	3	119,504,245 - 119,504,364	UniSTS	Rnor5.0
RGSC_v3.4	3	107,800,546 - 107,800,665	UniSTS	RGSC3.4
Celera	3	106,877,157 - 106,877,276	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015472 ⟹ ENSRNOP00000015472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	107,962,261 - 107,974,233 (+)	Ensembl
Rnor_6.0 Ensembl	3	112,950,890 - 112,961,614 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094907 ⟹ ENSRNOP00000077640

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	107,962,410 - 107,971,949 (+)	Ensembl

RefSeq Acc Id:

NM_001013204 ⟹ NP_001013222

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	128,416,230 - 128,427,985 (+)	NCBI
mRatBN7.2	3	107,962,477 - 107,974,234 (+)	NCBI
Rnor_6.0	3	112,951,065 - 112,961,620 (+)	NCBI
Rnor_5.0	3	119,494,005 - 119,504,497 (+)	NCBI
RGSC_v3.4	3	107,787,374 - 107,800,798 (+)	RGD
Celera	3	106,867,412 - 106,877,409 (+)	RGD

Sequence:

show sequence

GGCTGCGATGGCGAGCTCGACAACCCCAGTCTCGTTCCTTGCTCCTCCTCTAGAGCAGCTCCGG
CACTTAGCAGAGGAGCTGCGGTCGCTTCTGCCTCGAGTACGGGTCGGCGAAGCCCAGGAGACAG
CCGAGGAATTTAATCGAGAGATGTTTTGGAGAAGACTCAATGAAGCAGCAATGAAAGTGTCTGG
GGAAGCCACTGTTCTGACCACACTCTTCTCTAAAATTCCATCGCCATCTCCACAGGAAACCCAG
AGGATCTGTGAGCAAGTCCACATTGCCACTGAGGAAGTAATTGCAGCATACTACACATTTCCTA
AGGATCAGGGAATCACCCTGAGAAAGCTGGTACGAAATGCTGTCCTGGACATCGTGGATGGCAC
GGCTCAGCTCCTGGATGCGCTCCTTGCTGCTCCATCTCAGAGCCCTGAGAATGGTGACCTGATT
TCCTGCAATAGTGTCTCAGTTGCATGCCAACAGGTGGCTGAGATCCCAAAAGATAACAAAGCTG
CAGCCCTTTTGATGCTGACAAAGAGTGTGGATCTTGTGAAAGACGCTCATGAAGAAATGGAGCA
GGCCGTGGAAGAATGTGACCCTTACTGTGGCCTCTTGGATGATTCTGAGGACAACTCCGACAGC
CACCATAATGAGGATGGTGTAGGGCTTCCCAGCAATCGGGACTCATACTGGTCAGAGGAAGATC
AAGCACTCATAACTCCGTGCCTTGCATTGGTGAGAGCTTCCCGAGCTTCCCTCAAGAAAATCCG
GATCTTGGTGGCTGAGAATGGAAGGAAGGATCAGGTCGCCCAGCTGGATGACATTGTGGATATT
TCTGATGAGATCAGCCCCAGTGTGGATGACTTGGTTCTCAGCGTATATCCACCTGTGTGTCACC
TCACCGTGCGGATCACTTCTGCGAAACTGGTGTCTGTTTTAATAAAGGCTCTTGAGATTACAAA
AGCAAGTCACGTGAGCCCCCAGCCAGGAGATAGCTGGATCCCTTTACTCATTAATGCCGTTGAC
CATTGCATGGACAGAATTAAGGAGCTCACTCAGCGTGCAGTTGAGCTGTGAGCTTCCAGTCCTT
GTTCTTTCTCCCCTCCCTCTCGCACCCAAGCCAGTGTCCGCTTTCCTTATTTATTGTTAAGTGT
TTTCAGTGTCTGCTTTCGGAAGTGGAGCTGTGACAGGGTGTTTGCTGGATGGAAAGGAAGCTTC
TGTTTTTAAGAAGAGATTGTTATCAAGATTCTAGGCTAGGAGAGACTGCAGTTAGCTTCTGTGC
TAGACACAAATGTGTCCATGCTTGTACTCGGGGCTGATTTTTGGAAATTCTTAGGGAAGATGTC
TTGTTCTCTAGTTTATAGTAAAGTGTGTTGTTGTTTTATTAAGATTTTGATCATCTCAATAAAA
TGCTAACCTACTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105459 ⟹ XP_038961387

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	128,416,105 - 128,427,985 (+)	NCBI
mRatBN7.2	3	107,962,405 - 107,974,234 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013222	(Get FASTA)	NCBI Sequence Viewer
	XP_038961387	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91256	(Get FASTA)	NCBI Sequence Viewer
	EDL79969	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015472.5
	ENSRNOP00000077640.1
GenBank Protein	Q5BK06	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013222 ⟸ NM_001013204

- UniProtKB:

Q5BK06 (UniProtKB/Swiss-Prot), A0A0H2UHJ2 (UniProtKB/TrEMBL), A6HPL8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASSTTPVSFLAPPLEQLRHLAEELRSLLPRVRVGEAQETAEEFNREMFWRRLNEAAMKVSGEA
TVLTTLFSKIPSPSPQETQRICEQVHIATEEVIAAYYTFPKDQGITLRKLVRNAVLDIVDGTAQ
LLDALLAAPSQSPENGDLISCNSVSVACQQVAEIPKDNKAAALLMLTKSVDLVKDAHEEMEQAV
EECDPYCGLLDDSEDNSDSHHNEDGVGLPSNRDSYWSEEDQALITPCLALVRASRASLKKIRIL
VAENGRKDQVAQLDDIVDISDEISPSVDDLVLSVYPPVCHLTVRITSAKLVSVLIKALEITKAS
HVSPQPGDSWIPLLINAVDHCMDRIKELTQRAVEL

hide sequence

Ensembl Acc Id:

ENSRNOP00000015472 ⟸ ENSRNOT00000015472

RefSeq Acc Id:	XP_038961387 ⟸ XM_039105459
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000077640 ⟸ ENSRNOT00000094907

Protein Domains

Cyclin-D1-binding protein 1-like C-terminal Cyclin-D1-binding protein 1-like N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK06-F1-model_v2	AlphaFold	Q5BK06	1-355	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304669	AgrOrtholog
BioCyc Gene	G2FUF-48150	BioCyc
Ensembl Genes	ENSRNOG00000011379	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015472.6	UniProtKB/TrEMBL
	ENSRNOT00000094907.1	UniProtKB/TrEMBL
Gene3D-CATH	I/LWEQ domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Talin, central domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7375652	IMAGE-MGC_LOAD
InterPro	CCNDBP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GCIP-like_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GCIP_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:362201	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109078	IMAGE-MGC_LOAD
NCBI Gene	362201	ENTREZGENE
PANTHER	CYCLIN-D1-BINDING PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR15492	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	GCIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GCIP_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ccndbp1	PhenoGen
RatGTEx	ENSRNOG00000011379	RatGTEx
UniProt	A0A0H2UHJ2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y9N0_RAT	UniProtKB/TrEMBL
	A6HPL8	ENTREZGENE, UniProtKB/TrEMBL
	CCDB1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-04	Ccndbp1	cyclin D1 binding protein 1	Ccndbp1	cyclin D-type binding-protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ccndbp1	cyclin D-type binding-protein 1	Ccndbp1_predicted	cyclin D-type binding-protein 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ccndbp1_predicted	cyclin D-type binding-protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD