SST (somatostatin) - Rat Genome Database

SST (somatostatin) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: SST (somatostatin) Canis lupus familiaris

Subscribe to Updates

Symbol:

SST

Name:

somatostatin

RGD ID:

12420798

Description:

ENCODES a protein that exhibits identical protein binding (ortholog); INVOLVED IN hyperosmotic response (ortholog); response to acidic pH (ortholog); response to amino acid (ortholog); PARTICIPATES IN cimetidine pharmacodynamics pathway; esomeprazole pharmacodynamics pathway; famotidine pharmacodynamics pathway; ASSOCIATED WITH Barrett's esophagus (ortholog); disease of cellular proliferation (ortholog); endometriosis (ortholog); FOUND IN extracellular space (ortholog); neuronal cell body (ortholog); neuronal dense core vesicle (ortholog)

Type:

protein-coding

RefSeq Status:

Previously known as:

prosomatostatin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SST (somatostatin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sst (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Sst (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SST (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sst (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SST (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SST (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sst (somatostatin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

CanFam3.1 - Dog CanFam3.1 Assembly

Position:

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	20,063,091 - 20,064,520 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	20,063,090 - 20,064,557 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	24,155,973 - 24,157,402 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	19,983,105 - 19,984,534 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	19,983,111 - 19,984,571 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	20,011,742 - 20,013,171 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	20,005,493 - 20,006,922 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	20,245,365 - 20,246,794 (-)	NCBI		UU_Cfam_GSD_1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	gastric ulcer		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:17990461 and REF_RGD_ID:2303186
SST	Dog	hypertension		ISO	Sst (Rattus norvegicus)	9068941	protein:altered expression:stomach	RGD	PMID:17928643 and REF_RGD_ID:2303191
SST	Dog	vascular dementia		ISO	Sst (Rattus norvegicus)	9068941	protein:decreased expression:brain	RGD	PMID:18925713 and REF_RGD_ID:2303174

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	schizophrenia		ISO	SST (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	Barrett's esophagus		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:17999418
SST	Dog	disease of cellular proliferation		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:21692635
SST	Dog	endometriosis		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21063030
SST	Dog	Esophageal Neoplasms		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:17999418
SST	Dog	esophageal varix		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:1385068
SST	Dog	hypokalemia		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:2563217
SST	Dog	ischemia		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:18624922
SST	Dog	mood disorder		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:25600109
SST	Dog	Multiple Organ Failure		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:15834315
SST	Dog	pancreatic cancer		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:2868874
SST	Dog	pancreatitis		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:7911442
SST	Dog	Spontaneous Abortions		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18539642
SST	Dog	vipoma		ISO	SST (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:2868874

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	hyperosmotic response		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:18992283 and REF_RGD_ID:2303157
SST	Dog	regulation of cell migration	acts_upstream_of_or_within	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107
SST	Dog	regulation of cell migration	involved_in	IBA	MGI:98326 and PANTHER:PTN000059370	150520179		GO_Central	GO_REF:0000033
SST	Dog	regulation of postsynaptic membrane neurotransmitter receptor levels	involved_in	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107
SST	Dog	response to acidic pH		ISO	Sst (Rattus norvegicus)	9068941	HCl	RGD	PMID:18992283 and REF_RGD_ID:2303157
SST	Dog	response to amino acid		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:17961553 and REF_RGD_ID:2303188
SST	Dog	response to steroid hormone		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:18421448 and REF_RGD_ID:2303185
SST	Dog	response to xenobiotic stimulus		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:18800063 and REF_RGD_ID:2303175
SST	Dog	signal transduction	involved_in	IEA	GO:0005179 and GO:0048018	150520179		GOC	GO_REF:0000108
SST	Dog	somatostatin signaling pathway	involved_in	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	cytosol	is_active_in	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107
SST	Dog	extracellular region	located_in	IEA	InterPro:IPR004250 and InterPro:IPR018142	150520179		InterPro	GO_REF:0000002
SST	Dog	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
SST	Dog	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
SST	Dog	extracellular space		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:18992283 and REF_RGD_ID:2303157
SST	Dog	extracellular space	is_active_in	IBA	MGI:98326 more ...	150520179		GO_Central	GO_REF:0000033
SST	Dog	extracellular space	located_in	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107
SST	Dog	GABA-ergic synapse	is_active_in	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107
SST	Dog	neuronal cell body		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:18598846 and REF_RGD_ID:2303189
SST	Dog	neuronal dense core vesicle	is_active_in	ISO	Sst (Rattus norvegicus)	9068941	PMID:2422591	SynGO	PMID:2422591 and REF_RGD_ID:155230719

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	hormone activity	enables	IEA	InterPro:IPR004250 and InterPro:IPR018142	150520179		InterPro	GO_REF:0000002
SST	Dog	hormone activity	enables	IEA	UniProtKB-KW:KW-0372	150520179		UniProt	GO_REF:0000043
SST	Dog	identical protein binding	enables	ISO	UniProtKB:P61278-PRO_0000033088	9068941	PMID:15247250 more ...	IntAct	PMID:15247250 more ...
SST	Dog	protein binding	enables	ISO	UniProtKB:P05026	9068941	PMID:31136617	IntAct	PMID:31136617
SST	Dog	protein binding	enables	ISO	UniProtKB:P05067-PRO_0000000092	9068941	PMID:28650319 and PMID:32915532	IntAct	PMID:28650319 and PMID:32915532
SST	Dog	protein binding	enables	ISO	UniProtKB:P05067	9068941	PMID:32814053	IntAct	PMID:32814053
SST	Dog	receptor ligand activity	enables	IEA	UniProtKB:P60041 and ensembl:ENSMUSP00000004480	150520179		Ensembl	GO_REF:0000107
SST	Dog	receptor ligand activity	enables	IEA	ARBA:ARBA00028558	150520179		UniProt	GO_REF:0000117

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	somatostatin signaling pathway		ISO	SST (Homo sapiens)	9068941		RGD	PMID:17021051 and REF_RGD_ID:1641809
SST	Dog	somatostatin signaling pathway		ISO	Sst (Rattus norvegicus)	9068941		RGD	PMID:17021051 and REF_RGD_ID:1641809
SST	Dog	somatostatin signaling pathway		ISO	Sst (Mus musculus)	9068941		RGD	PMID:17021051 and REF_RGD_ID:1641809

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SST	Dog	cimetidine pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00232
SST	Dog	esomeprazole pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00225
SST	Dog	famotidine pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00231
SST	Dog	lansoprazole pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00227
SST	Dog	nizatidine pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00233
SST	Dog	omeprazole pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00226
SST	Dog	pantoprazole pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00228
SST	Dog	pirenzepine pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00246
SST	Dog	rabeprazole pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00229
SST	Dog	ranitidine pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00230
SST	Dog	roxatidine acetate pharmacodynamics pathway		ISO	SST (Homo sapiens)	9068941		SMPDB	SMP:00734

PMID:8988514	PMID:22301074	PMID:30032202

SST
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	20,063,091 - 20,064,520 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	20,063,090 - 20,064,557 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	24,155,973 - 24,157,402 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	19,983,105 - 19,984,534 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	19,983,111 - 19,984,571 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	20,011,742 - 20,013,171 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	20,005,493 - 20,006,922 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	20,245,365 - 20,246,794 (-)	NCBI		UU_Cfam_GSD_1.0

SST
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	187,668,912 - 187,670,394 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	187,668,912 - 187,670,394 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	187,386,700 - 187,388,182 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	188,869,388 - 188,870,895 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	188,869,406 - 188,870,808	NCBI
Celera	3	185,817,667 - 185,819,174 (-)	NCBI		Celera
Cytogenetic Map	3	q27.3	NCBI
HuRef	3	184,791,007 - 184,792,514 (-)	NCBI		HuRef
CHM1_1	3	187,349,954 - 187,351,461 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	190,486,363 - 190,487,845 (-)	NCBI		T2T-CHM13v2.0

Sst
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	23,708,327 - 23,710,041 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	23,708,323 - 23,709,708 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	23,889,573 - 23,891,342 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	23,889,573 - 23,890,958 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	23,889,667 - 23,890,930 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	23,804,930 - 23,806,193 (-)	NCBI		MGSCv36	mm8
Celera	16	24,439,585 - 24,440,848 (-)	NCBI		Celera
Cytogenetic Map	16	B1	NCBI
cM Map	16	15.0	NCBI

Sst
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	90,461,546 - 90,462,823 (+)	NCBI		GRCr8
mRatBN7.2	11	76,956,896 - 76,958,173 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	76,956,896 - 76,958,173 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	85,714,888 - 85,716,167 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	78,350,097 - 78,351,376 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	77,429,193 - 77,430,472 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	80,358,172 - 80,359,449 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	80,358,211 - 80,359,444 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	80,374,262 - 80,375,447 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	79,125,031 - 79,126,216 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	79,182,619 - 79,183,805 (+)	NCBI
Celera	11	75,836,256 - 75,837,533 (+)	NCBI		Celera
RH 3.4 Map	11	640.6	RGD
Cytogenetic Map	11	q23	NCBI

SST
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	185,539,811 - 185,541,321 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	185,544,525 - 185,546,059 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	184,695,561 - 184,697,091 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	193,156,526 - 193,158,020 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	193,155,363 - 193,158,337 (-)	Ensembl	panpan1.1		panPan2

Sst
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	116,372,454 - 116,373,819 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936578	2,464,212 - 2,465,701 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936578	2,464,310 - 2,465,673 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SST
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	125,337,418 - 125,338,850 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	125,337,560 - 125,338,742 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	134,621,119 - 134,622,301 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SST
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	81,946,287 - 81,947,775 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	81,946,206 - 81,947,790 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	55,444,092 - 55,445,581 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sst
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	69,213,781 - 69,215,477 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	69,213,917 - 69,215,296 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in SST
7 total Variants

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
6	5	5	23	21	15	5	6	5	6	31	21	12	14	10


RefSeq Transcripts	NM_001003307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AAEX04000034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAHUQ010000339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAQRD010000079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAUVH010000363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L42325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	REHQ01000034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCAFT00000022039 ⟹ ENSCAFP00000020465

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	34	20,063,097 - 20,064,557 (-)	Ensembl

Ensembl Acc Id:

ENSCAFT00000067680 ⟹ ENSCAFP00000064277

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	34	20,063,090 - 20,064,445 (-)	Ensembl

Ensembl Acc Id:

ENSCAFT00845040007 ⟹ ENSCAFP00845031328

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	34	19,983,111 - 19,984,571 (-)	Ensembl

RefSeq Acc Id:

NM_001003307 ⟹ NP_001003307

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	34	20,063,091 - 20,064,520 (-)	NCBI
Dog10K_Boxer_Tasha	34	24,155,973 - 24,157,402 (-)	NCBI
ROS_Cfam_1.0	34	19,983,105 - 19,984,534 (-)	NCBI
UMICH_Zoey_3.1	34	20,011,742 - 20,013,171 (-)	NCBI
UNSW_CanFamBas_1.0	34	20,005,493 - 20,006,922 (-)	NCBI
UU_Cfam_GSD_1.0	34	20,245,365 - 20,246,794 (-)	NCBI

Sequence:

show sequence

TGCCGCTGCTGCCTGCGGAGCCTCCCCTAGAGGTTGACCAGCCGTCCTCCGGCTCGGCTTCCCCGCGCCGCCGAGATGCTGTCCTGCCGCCTCCAGTGCGCGCTGGCCGCGCTGTCCATCGTCCTGGC
TCTGGGCGGTGTCACCTGCGCGCCCTCGGACCCCCGACTCCGCCAGTTTCTGCAGAAGTCCCTGGCTGCCGCCGCGGGGAAGCAGGAACTGGCCAAGTACTTCTTGGCAGAGCTGCTGTCTGAACCCA
ACCAGACAGAGAATGATGCCCTGGAACCTGAAGATTTGTCCCAGGCTGCTGAGCAGGATGAAATGAGGCTGGAACTGCAGAGATCTGCTAACTCAAACCCCGCCATGGCACCCCGAGAACGCAAAGCT
GGCTGCAAGAATTTCTTCTGGAAGACTTTCACATCCTGTTAGCTTTATTAATTATTGTTGTCCATATAAGACCTCTGATTCCTTTCCTCCAAACCTCATCCCACTTCCCTAATCCCCCAATCCTCAGC
AAGACCCTTGCATTAGAAATTGAAGACTGTAATACAAAATAAAATTATGGTGAAATTATGAAAAAC

hide sequence


Protein RefSeqs	NP_001003307	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA67099	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCAFP00000020465.3
	ENSCAFP00030031050.1
	ENSCAFP00040029464.1
	ENSCAFP00845031328
	ENSCAFP00845031328.1
GenBank Protein	P49670	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001003307 ⟸ NM_001003307
- Peptide Label:	precursor
- UniProtKB:	P49670 (UniProtKB/Swiss-Prot), A0A8C0L2X7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLSCRLQCALAALSIVLALGGVTCAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC hide sequence

Ensembl Acc Id:

ENSCAFP00000064277 ⟸ ENSCAFT00000067680

Ensembl Acc Id:

ENSCAFP00000020465 ⟸ ENSCAFT00000022039

Ensembl Acc Id:

ENSCAFP00845031328 ⟸ ENSCAFT00845040007

Protein Domains

Somatostatin/Cortistatin C-terminal

RGD ID:

Promoter ID:

Type:

single initiation site

Name:

SST_1

Description:

somatostatin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	34	20,064,551 - 20,064,611	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSCAFG00000013891	Ensembl, UniProtKB/Swiss-Prot
	ENSCAFG00030019362	UniProtKB/Swiss-Prot
	ENSCAFG00040018320	UniProtKB/Swiss-Prot
	ENSCAFG00845022661	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSCAFT00000022039.5	UniProtKB/Swiss-Prot
	ENSCAFT00030035606.1	UniProtKB/Swiss-Prot
	ENSCAFT00040033861.1	UniProtKB/Swiss-Prot
	ENSCAFT00845040007	ENTREZGENE
	ENSCAFT00845040007.1	UniProtKB/Swiss-Prot
InterPro	Somatostatin	UniProtKB/Swiss-Prot
	Somatostatin/Cortistatin_C	UniProtKB/Swiss-Prot
KEGG Report	cfa:403993	UniProtKB/Swiss-Prot
NCBI Gene	SST	ENTREZGENE
PANTHER	PTHR10558	UniProtKB/Swiss-Prot
	SOMATOSTATIN	UniProtKB/Swiss-Prot
Pfam	Somatostatin	UniProtKB/Swiss-Prot
PIRSF	Somatostatin	UniProtKB/Swiss-Prot
UniProt	A0A8C0L2X7	ENTREZGENE
	A0A8C0T1Q8_CANLF	UniProtKB/TrEMBL
	P49670	ENTREZGENE, UniProtKB/Swiss-Prot
VGNC ID	VGNC:46842	ENTREZGENE