Symbol:
PRM2
Name:
protamine 2
RGD ID:
12286934
Description:
ENCODES a protein that exhibits cadmium ion binding (ortholog); zinc ion binding (ortholog); INVOLVED IN nucleus organization (ortholog); spermatid development (ortholog); ASSOCIATED WITH Charcot-Marie-Tooth disease type 1C (ortholog); Landau-Kleffner syndrome (ortholog); MHC class II deficiency (ortholog); FOUND IN cytoplasm (ortholog); male germ cell nucleus (ortholog)
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
protamine-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRM2 (protamine 2)
HGNC
NCBI
Mus musculus (house mouse):
Prm2 (protamine 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Prm2 (protamine 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRM2 (protamine 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRM2 (protamine 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRM2 (protamine 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prm2 (protamine 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
CanFam3.1 - Dog CanFam3.1 Assembly
Position:
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 31,492,208 - 31,492,852 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 31,492,208 - 31,492,852 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 32,875,074 - 32,875,718 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 31,674,848 - 31,675,492 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 31,674,848 - 31,675,492 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 31,488,145 - 31,488,789 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 31,362,449 - 31,363,093 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 31,786,678 - 31,787,322 (+) NCBI UU_Cfam_GSD_1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
PRM2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 31,492,208 - 31,492,852 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 31,492,208 - 31,492,852 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 32,875,074 - 32,875,718 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 31,674,848 - 31,675,492 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 31,674,848 - 31,675,492 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 31,488,145 - 31,488,789 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 31,362,449 - 31,363,093 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 31,786,678 - 31,787,322 (+) NCBI UU_Cfam_GSD_1.0
PRM2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 11,275,639 - 11,276,480 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 11,275,639 - 11,276,480 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 11,369,496 - 11,370,337 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 11,276,994 - 11,277,838 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 11,276,997 - 11,277,809 NCBI Celera 16 11,538,883 - 11,539,727 (-) NCBI Celera Cytogenetic Map 16 p13.13 NCBI HuRef 16 11,287,224 - 11,288,068 (-) NCBI HuRef CHM1_1 16 11,369,399 - 11,370,243 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 11,311,859 - 11,312,700 (-) NCBI T2T-CHM13v2.0
Prm2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 10,609,241 - 10,609,969 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 10,609,244 - 10,613,998 (-) Ensembl GRCm39 Ensembl GRCm38 16 10,791,377 - 10,792,105 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 10,791,380 - 10,796,134 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 10,791,474 - 10,792,190 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 10,704,959 - 10,705,675 (-) NCBI MGSCv36 mm8 Celera 16 11,418,811 - 11,419,527 (-) NCBI Celera Cytogenetic Map 16 A1 NCBI cM Map 16 5.84 NCBI
Prm2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 5,383,208 - 5,383,949 (+) NCBI GRCr8 mRatBN7.2 10 4,876,285 - 4,877,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 4,873,372 - 4,877,026 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 9,572,973 - 9,573,409 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 9,094,089 - 9,094,525 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 4,732,370 - 4,732,806 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 4,950,484 - 4,950,920 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 4,950,484 - 4,950,920 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 3,776,970 - 3,777,406 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 4,813,692 - 4,814,128 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 4,813,691 - 4,814,128 (+) NCBI Celera 10 3,897,994 - 3,898,430 (+) NCBI Celera Cytogenetic Map 10 q11 NCBI
PRM2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 11,824,801 - 11,825,700 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 15,595,263 - 15,596,125 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 10,217,586 - 10,218,446 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 11,439,417 - 11,440,265 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 11,439,417 - 11,440,265 (-) Ensembl panpan1.1 panPan2
PRM2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 31,864,350 - 31,864,961 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 31,864,350 - 31,864,959 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 32,653,946 - 32,654,670 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRM2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 10,752,537 - 10,753,414 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 10,752,804 - 10,753,273 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 19,410,480 - 19,411,489 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prm2 (Heterocephalus glaber - naked mole-rat)
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCAFT00000081333 ⟹ ENSCAFP00000060926
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source CanFam3.1 Ensembl 6 31,492,208 - 31,492,852 (+) Ensembl
Ensembl Acc Id:
ENSCAFT00845023010 ⟹ ENSCAFP00845018039
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source ROS_Cfam_1.0 Ensembl 6 31,674,848 - 31,675,492 (+) Ensembl
RefSeq Acc Id:
NM_001287148 ⟹ NP_001274077
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Dog Assembly Chr Position (strand) Source CanFam3.1 6 31,492,208 - 31,492,852 (+) NCBI Dog10K_Boxer_Tasha 6 32,875,074 - 32,875,718 (+) NCBI ROS_Cfam_1.0 6 31,674,848 - 31,675,492 (+) NCBI UMICH_Zoey_3.1 6 31,488,145 - 31,488,789 (+) NCBI UNSW_CanFamBas_1.0 6 31,362,449 - 31,363,093 (+) NCBI UU_Cfam_GSD_1.0 6 31,786,678 - 31,787,322 (+) NCBI
Sequence:
CCAACATCAACAGCAAGCGCAGGTGGGCAGGCCTCAGCCCTCCTCCCCCACCCCAAGGCCAGCTGCAGCCTCAGCCTCCGCCACCTGCCCGGCCAGCACGATGGTCCGATGCCGCGGGAGGAGTCCCA GCGAACATCCACAGCATGGGCATGAGCAGCAGCGACAGTGCCAGGAGCAGGAGGAGGAGCAGGCTGTGAACCCCGAGGACATCCCCACGGCCGAAGGAAGGACCAACAAAGACTATCACTACAGACAC AGGCACTGCTCCCGGAGGCGACGGTACAGGGTCCACCGGAGGCGGCGACGCTCCTGCCGGAGGCGCCGCAGACGGGCCTGCAGGCACAGGAGACATCACCGAGGCTCCAGAAGGGTCAGGAGGAGGAG ATACAGGAGGTGCCACTAAACCTTCCCGGGCCCATTGGCACCCCCGGCTGGAAAGTAAGGAAAAGTCACCCGCCGGAGAACCACCTCGCGAGACAACGGCGATCCCCCGACCTGGGATGCCCAAGCCC TGAGTTTGCAAGGAGCCCACAAAATTGTGACTAAAATGAGCCCGAGTCATCT
hide sequence
RefSeq Acc Id:
NP_001274077 ⟸ NM_001287148
- UniProtKB:
F7VJL5 (UniProtKB/TrEMBL), A0A8C0RXS1 (UniProtKB/TrEMBL)
- Sequence:
MVRCRGRSPSEHPQHGHEQQRQCQEQEEEQAVNPEDIPTAEGRTNKDYHYRHRHCSRRRRYRVHRRRRRSCRRRRRRACRHRRHHRGSRRVRRRRYRRCH
hide sequence
Ensembl Acc Id:
ENSCAFP00000060926 ⟸ ENSCAFT00000081333
Ensembl Acc Id:
ENSCAFP00845018039 ⟸ ENSCAFT00845023010