Aatf (apoptosis antagonizing transcription factor)

Advanced Search (OLGA)

Gene: Aatf (apoptosis antagonizing transcription factor) Rattus norvegicus

Analyze

Symbol:

Aatf

Name:

apoptosis antagonizing transcription factor

RGD ID:

620685

Description:

Enables leucine zipper domain binding activity; protein kinase binding activity; and tau protein binding activity. Involved in negative regulation of apoptotic process and positive regulation of DNA-templated transcription. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be part of small-subunit processome and transcription regulator complex. Predicted to be active in nucleolus. Orthologous to human AATF (apoptosis antagonizing transcription factor); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

apoptosis-antagonizing transcription factor; Ded

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AATF (apoptosis antagonizing transcription factor)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Aatf (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Aatf (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AATF (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AATF (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Aatf (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AATF (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AATF (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Aatf (apoptosis antagonizing transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AATF (apoptosis antagonizing transcription factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Aatf (apoptosis antagonizing transcription factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	aatf (apoptosis antagonizing transcription factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Aatf	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BFR2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y73E7A.2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	aatf	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	69,796,502 - 69,889,671 (-)	NCBI		GRCr8
mRatBN7.2	10	69,299,029 - 69,392,207 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	69,299,037 - 69,392,201 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	73,919,023 - 74,012,160 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	73,424,050 - 73,517,193 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	68,888,465 - 68,981,611 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	71,744,648 - 71,837,851 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	71,744,659 - 71,837,851 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	71,654,744 - 71,747,166 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	72,701,724 - 72,794,495 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	72,716,103 - 72,808,865 (-)	NCBI
Celera	10	68,226,097 - 68,318,677 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

chromosome 17q12 deletion syndrome (ISO)

hyperphosphatasia with impaired intellectual development syndrome 5 (ISO)

Neurodevelopmental Disorders (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-alpha-phellandrene (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

alpha-phellandrene (ISO)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

coumarin (ISO)

cyclosporin A (ISO)

DDE (ISO)

dibutyl phthalate (EXP)

elemental selenium (ISO)

enzyme inhibitor (ISO)

fipronil (EXP)

flavonoids (EXP)

flutamide (EXP)

FR900359 (ISO)

hydroquinone (ISO)

ivermectin (ISO)

ketoconazole (EXP)

oxaliplatin (EXP)

ozone (ISO)

p-menthan-3-ol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

PF-3758309 (ISO)

resveratrol (ISO)

rotenone (ISO)

selenium atom (ISO)

sevoflurane (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

tamoxifen (ISO)

tauroursodeoxycholic acid (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cell adhesion (ISO)

embryonic cleavage (ISO)

negative regulation of amyloid precursor protein biosynthetic process (ISO)

negative regulation of apoptotic process (IDA)

negative regulation of apoptotic signaling pathway (ISO)

positive regulation of DNA-templated transcription (IDA)

regulation of mitotic cell cycle (ISO)

ribosomal small subunit biogenesis (ISO)

ribosome biogenesis (ISO)

Cellular Component

cytoplasm (ISO)

nucleolus (IBA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

small-subunit processome (ISO)

transcription regulator complex (ISO)

Molecular Function

leucine zipper domain binding (IPI,ISO)

protein binding (ISO)

protein kinase binding (IPI)

tau protein binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Rb binding protein Che-1 interacts with Tau in cerebellar granule neurons. Modulation during neuronal apoptosis.	Barbato C, etal., Mol Cell Neurosci. 2003 Dec;24(4):1038-50.
2.	TSG101 interacts with apoptosis-antagonizing transcription factor and enhances androgen receptor-mediated transcription by promoting its monoubiquitination.	Burgdorf S, etal., J Biol Chem 2004 Apr 23;279(17):17524-34. Epub 2004 Feb 2.
3.	Characterization of rat BLOS2/Ceap, a putative yeast She3 homolog, as interaction partner of apoptosis antagonizing transcription factor/Che-1.	Felten A, etal., Biol Chem. 2007 Jun;388(6):569-82.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	AATF, a novel transcription factor that interacts with Dlk/ZIP kinase and interferes with apoptosis.	Page G, etal., FEBS Lett 1999 Nov 26;462(1-2):187-91.
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:10602480	PMID:11071758	PMID:12429849	PMID:14627703	PMID:15207272	PMID:15489334	PMID:17488777	PMID:18049476	PMID:19911006	PMID:22658674	PMID:22681889	PMID:23007641

Genomics

Comparative Map Data

Aatf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	69,796,502 - 69,889,671 (-)	NCBI		GRCr8
mRatBN7.2	10	69,299,029 - 69,392,207 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	69,299,037 - 69,392,201 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	73,919,023 - 74,012,160 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	73,424,050 - 73,517,193 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	68,888,465 - 68,981,611 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	71,744,648 - 71,837,851 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	71,744,659 - 71,837,851 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	71,654,744 - 71,747,166 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	72,701,724 - 72,794,495 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	72,716,103 - 72,808,865 (-)	NCBI
Celera	10	68,226,097 - 68,318,677 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

AATF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	36,948,954 - 37,056,871 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	36,948,925 - 37,056,871 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	35,306,254 - 35,414,171 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	32,380,288 - 32,488,284 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	32,380,370 - 32,488,283	NCBI
Celera	17	32,128,305 - 32,236,266 (+)	NCBI		Celera
Cytogenetic Map	17	q12	NCBI
HuRef	17	31,242,118 - 31,349,732 (+)	NCBI		HuRef
CHM1_1	17	35,340,438 - 35,448,434 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	37,936,011 - 38,043,848 (+)	NCBI		T2T-CHM13v2.0

Aatf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	84,313,682 - 84,404,433 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	84,313,681 - 84,404,348 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	84,422,856 - 84,513,584 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	84,422,855 - 84,513,522 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	84,236,358 - 84,327,003 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	84,239,051 - 84,329,696 (-)	NCBI		MGSCv36	mm8
Celera	11	94,034,340 - 94,126,318 (-)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	51.3	NCBI

Aatf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	929,510 - 1,033,492 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	929,278 - 1,033,665 (-)	NCBI	ChiLan1.0	ChiLan1.0

AATF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	27,706,527 - 27,808,516 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	29,588,204 - 29,690,174 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	20,027,351 - 20,129,255 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	20,325,282 - 20,426,359 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	20,325,282 - 20,426,359 (-)	Ensembl	panpan1.1		panPan2

AATF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	36,773,313 - 36,878,752 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	36,773,312 - 36,878,745 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	35,998,704 - 36,107,988 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	37,583,095 - 37,693,391 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	37,582,958 - 37,689,359 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	36,364,898 - 36,474,825 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	36,652,569 - 36,762,368 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	36,739,791 - 36,849,296 (+)	NCBI		UU_Cfam_GSD_1.0

Aatf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	35,755,004 - 35,865,290 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	1,209,967 - 1,319,802 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	1,209,760 - 1,320,046 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AATF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	38,461,830 - 38,564,306 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	38,461,809 - 38,563,537 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	40,078,719 - 40,180,472 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AATF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	30,728,070 - 30,838,816 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	30,728,070 - 30,838,704 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	1,459,496 - 1,571,604 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Aatf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624871	3,965,985 - 4,079,281 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624871	3,966,323 - 4,078,970 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Aatf
337 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	33
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000000258
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631565	Hcuc4	Hepatic copper content QTL 4	4.15		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	10	66941813	73452992	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	65927233	82565079	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61345276	81714865	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61345413	82564856	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67502108	73579767	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

RH128909

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	18	368.3	UniSTS
Cytogenetic Map	10	q26	UniSTS

BF389770

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	69,369,101 - 69,369,239 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,814,714 - 71,814,851	NCBI	Rnor6.0
Rnor_5.0	10	71,723,990 - 71,724,127	UniSTS	Rnor5.0
RGSC_v3.4	10	72,771,085 - 72,771,222	UniSTS	RGSC3.4
Celera	10	68,296,149 - 68,296,286	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH131120

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	79,672,348 - 79,672,544 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	69,380,865 - 69,381,070 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,826,475 - 71,826,679	NCBI	Rnor6.0
Rnor_6.0	1	80,939,650 - 80,939,845	NCBI	Rnor6.0
Rnor_5.0	10	71,735,940 - 71,736,144	UniSTS	Rnor5.0
Rnor_5.0	1	82,204,907 - 82,205,102	UniSTS	Rnor5.0
RGSC_v3.4	1	79,325,823 - 79,326,018	UniSTS	RGSC3.4
RGSC_v3.4	10	72,782,871 - 72,783,075	UniSTS	RGSC3.4
Celera	10	68,307,916 - 68,308,120	UniSTS
Celera	1	74,128,309 - 74,128,504	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH137486

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	69,365,055 - 69,365,260 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	71,810,667 - 71,810,871	NCBI	Rnor6.0
Rnor_5.0	10	71,719,943 - 71,720,147	UniSTS	Rnor5.0
RGSC_v3.4	10	72,767,038 - 72,767,242	UniSTS	RGSC3.4
Celera	10	68,292,102 - 68,292,306	UniSTS
Cytogenetic Map	10	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ238717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000258 ⟹ ENSRNOP00000000258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	69,299,037 - 69,392,201 (-)	Ensembl
Rnor_6.0 Ensembl	10	71,744,659 - 71,837,851 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096448 ⟹ ENSRNOP00000076475

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	69,324,005 - 69,392,196 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113383 ⟹ ENSRNOP00000092466

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	69,299,037 - 69,392,201 (-)	Ensembl

RefSeq Acc Id:

NM_053720 ⟹ NP_446172

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	69,796,502 - 69,889,634 (-)	NCBI
mRatBN7.2	10	69,299,029 - 69,392,174 (-)	NCBI
Rnor_6.0	10	71,744,648 - 71,837,851 (-)	NCBI
Rnor_5.0	10	71,654,744 - 71,747,166 (-)	NCBI
RGSC_v3.4	10	72,701,724 - 72,794,495 (-)	RGD
Celera	10	68,226,097 - 68,318,677 (-)	RGD

Sequence:

show sequence

GAACGCTGCCTCCGCGAGGTCCCCGCTTGTACTTGCGGAGTAGAGTCGGGCTGTAGCACCGCTG
ACGGGAGTGTCGTGCCCGGGCTCGGCCTCCAGGTTCACGAGCGCAGTGCCGACAGTGACCTGGT
GACCATGGCGGAGCTGCAGCCCCTGGCTCTGCAGCTGGAACAGTTGTTGAATCCAAGACCGCGT
GAGGCGGATCCTGAGGCGGACCCGGAGGAGGCCACTAGAGCCAGAGTGATTGACAGGTTTGATG
AAGGGGAAGAGGAAGAAGATGATCTGCCAGTGAGTAGTATTAGAAAGTTGGCACCGGTCTCCCT
CTTGGACACCGACAAAAGGTATTCTGGCAAGACCACTTCTCGGAAAGCTTGGAAAGAAGACCAT
TGGGACCAGACTCTGCCAAGTTCATCGGACAATGAAATACCTGATGAAGGAGGCTCTGAAGCTG
GGGATTCAGAGGGCCTGGAGGAGCTCTCAGAAGATGTTGAGGAAGACTTGGAAGACAATGAAAT
ACCTGATGAAGGAGGCTCTGAAGATGGGGATTCAGAGGGCCTGGAGGAGGAGATCTCAGAAGAT
GTTGAGGAAGACTTAGAAGGTGAGGATGAGGAAGACAGAGAAGAGGACAGGAACAGTGAAGATG
ACGGCGTGGTGATGGCCTTCTCCGGTGTTAAAGTTTCTGAGGAAGTGGAAAAAGGAAGAGCTGT
GAAGAACCAGATAGCGTTGTGGGACCAGCTCTTGGAAGGAAGGATCAAACTACAAAAAGCTCTC
TTGACTACCAATCAATTGCCTCAACCAGATGTTTTCCCTGTCTTCAAGGACAAAGGTGGCCCAG
AATTTGCCAGTGCTCTGAAAAATAGTCACAAAGCACTTAAAGCATTGTTAAGATCATTGGTGGA
TCTTCAGGAAGAGTTGCTTTTCCAGTACCCAGATACAAGATATTTAGTAAAAGGGACGAAACCC
AATGCAGAGAGTGAGGAGATTTCCAGTGAAGATGATGAGCTAGTGGGAGAGAAGAAGAAACAAA
GAAAGGCCCCACCAAAGAGGAAGCTAGAGATGGAGGACTATCCCAGCTTCATGGCAAAGCGCTC
TGCTGACTTTACCGTCTACAGGAACCGCACACTACAAAAATGGCATGATAAAACCAAGCTTGCT
TCTGGAAAACTGGGCAAGGGTTTCGGTGCCTTTGAACGCTCCATCTTGACTCAGATTGATCATA
TTCTGATGGACAAAGAAAGATTACTTCGAAGGACGCAGACCAAGCGCTCTGCCTACCGAGTTCT
TGGCAAACCTGAGCCAGTCCCTGAGCCTGTTGCAGAGACTTTGCCAGGAGAACCGGAGAGCCTT
CCTCAGGTCCCTGCCAATGCTCACCTGAAGGACTTGGACGAGGAGATATTTGATGATGATGACT
TCTACCACCAGCTCCTTCGAGAACTCATAGAGCGGAAGACCAGCTCTTTGGATCCAAATGATCA
GGTGGCCATGGGAAGGCAGTGGCTTGCAATCCAGAAACTACGAAGCAAAATCCGCAAGAAGGTA
GATAGAAAAGCCAGCAAAGGAAGAAAACTTCGGTTCCATGTGCTTAGCAAGCTCCTGAGTTTCA
TGGCGCCTATTGACCACACTGCAATGAATGATGAGGCCAGGACCGAGTTGTATCGATCTCTTTT
CGGCCAGCTCAACCGTCTGGACGCAGACCATGGGCAGTGACATTAGCATCCTCTCACGCTAACC
TCTCACAGGACCCACCTGCTGCTTCCATTAAAATGGTCGAAACTACAATAAATCTTTTTTTAAA
AAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085037 ⟹ XP_038940965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	69,861,660 - 69,889,671 (-)	NCBI
mRatBN7.2	10	69,367,910 - 69,392,207 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446172	(Get FASTA)	NCBI Sequence Viewer
	XP_038940965	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78769	(Get FASTA)	NCBI Sequence Viewer
	CAB59426	(Get FASTA)	NCBI Sequence Viewer
	EDM05512	(Get FASTA)	NCBI Sequence Viewer
	EDM05513	(Get FASTA)	NCBI Sequence Viewer
	EDM05514	(Get FASTA)	NCBI Sequence Viewer
	EDM05515	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000258.4
	ENSRNOP00000076475.1
	ENSRNOP00000092466.1
	ENSRNOP00055038093
	ENSRNOP00060035961
	ENSRNOP00065026206
GenBank Protein	Q9QYW0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446172 ⟸ NM_053720

- UniProtKB:

Q9QYW0 (UniProtKB/Swiss-Prot), A6HHK8 (UniProtKB/TrEMBL), A0A8I5Y0A8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAELQPLALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEEDDLPVSSIRKLAPVSLL
DTDKRYSGKTTSRKAWKEDHWDQTLPSSSDNEIPDEGGSEAGDSEGLEELSEDVEEDLEDNEIP
DEGGSEDGDSEGLEEEISEDVEEDLEGEDEEDREEDRNSEDDGVVMAFSGVKVSEEVEKGRAVK
NQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASALKNSHKALKALLRSLVDL
QEELLFQYPDTRYLVKGTKPNAESEEISSEDDELVGEKKKQRKAPPKRKLEMEDYPSFMAKRSA
DFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSAYRVLG
KPEPVPEPVAETLPGEPESLPQVPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQV
AMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTAMNDEARTELYRSLFG
QLNRLDADHGQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000000258 ⟸ ENSRNOT00000000258

RefSeq Acc Id:	XP_038940965 ⟸ XM_039085037
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000076475 ⟸ ENSRNOT00000096448

Ensembl Acc Id:

ENSRNOP00000092466 ⟸ ENSRNOT00000113383

Protein Domains

AATF leucine zipper-containing Apoptosis-antagonizing transcription factor C-

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QYW0-F1-model_v2	AlphaFold	Q9QYW0	1-523	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697549

Promoter ID:

EPDNEW_R8074

Type:

initiation region

Name:

Aatf_1

Description:

apoptosis antagonizing transcription factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	71,837,851 - 71,837,911	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620685	AgrOrtholog
BioCyc Gene	G2FUF-23842	BioCyc
Ensembl Genes	ENSRNOG00000002778	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055026875	UniProtKB/Swiss-Prot
	ENSRNOG00060025055	UniProtKB/Swiss-Prot
	ENSRNOG00065019443	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000258.5	UniProtKB/Swiss-Prot
	ENSRNOT00000096448.1	UniProtKB/TrEMBL
	ENSRNOT00000113383.1	UniProtKB/TrEMBL
	ENSRNOT00055046442	UniProtKB/Swiss-Prot
	ENSRNOT00060043410	UniProtKB/Swiss-Prot
	ENSRNOT00065032781	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7110171	IMAGE-MGC_LOAD
InterPro	AATF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AATF/Bfr2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AATF_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114512	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93285	IMAGE-MGC_LOAD
NCBI Gene	114512	ENTREZGENE
PANTHER	PROTEIN AATF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR15565	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	AATF-Che1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRAUB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Aatf	PhenoGen
RatGTEx	ENSRNOG00000002778	RatGTEx
	ENSRNOG00055026875	RatGTEx
	ENSRNOG00060025055	RatGTEx
	ENSRNOG00065019443	RatGTEx
UniProt	A0A8I5Y0A8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AI79_RAT	UniProtKB/TrEMBL
	A6HHK7_RAT	UniProtKB/TrEMBL
	A6HHK8	ENTREZGENE, UniProtKB/TrEMBL
	A6HHK9_RAT	UniProtKB/TrEMBL
	A6HHL0_RAT	UniProtKB/TrEMBL
	AATF_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Aatf	apoptosis antagonizing transcription factor	Ded		Symbol updated	625702	APPROVED
2002-08-07	Ded	apoptosis antagonizing transcription factor			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the nucleus
gene_domains	contains an extremely acidic domain and a putative leucine zipper
gene_product	523 amino acids, 1.8 kb mRNA

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar