Symbol:
Nphs1
Name:
NPHS1 adhesion molecule, nephrin
RGD ID:
620460
Description:
Enables alpha-actinin binding activity; protein domain specific binding activity; and spectrin binding activity. Predicted to be involved in several processes, including myoblast fusion; skeletal muscle tissue development; and slit diaphragm assembly. Predicted to act upstream of or within several processes, including JNK cascade; cell adhesion; and positive regulation of actin filament polymerization. Located in basement membrane; plasma membrane; and slit diaphragm. Part of protein-containing complex. Biomarker of end stage renal disease; kidney failure; membranous glomerulonephritis; and nephrotic syndrome. Human ortholog(s) of this gene implicated in nephrotic syndrome type 1. Orthologous to human NPHS1 (NPHS1 adhesion molecule, nephrin); INTERACTS WITH 5-hydroxymethylfurfural; mycophenolate mofetil; streptozocin.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
nephrin; nephrosis 1 homolog (human); nephrosis 1 homolog, nephrin; nephrosis 1 homolog, nephrin (human); nephrosis 1, congenital, Finnish type; nephrosis 1, congenital, Finnish type (nephrin); NPHS1 nephrin; renal glomerulus-specific cell adhesion receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NPHS1 (NPHS1 adhesion molecule, nephrin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nphs1 (nephrosis 1, nephrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nphs1 (NPHS1 adhesion molecule, nephrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NPHS1 (NPHS1 adhesion molecule, nephrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nphs1 (NPHS1 adhesion molecule, nephrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NPHS1 (NPHS1 adhesion molecule, nephrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nphs1 (NPHS1 adhesion molecule, nephrin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NPHS1 (NPHS1 adhesion molecule, nephrin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, Treefam
Alliance orthologs 3
Homo sapiens (human):
NPHS1 (NPHS1 adhesion molecule, nephrin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nphs1 (nephrosis 1, nephrin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nphs1 (NPHS1 adhesion molecule, nephrin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
syg-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
sns
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nphs1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 94,848,261 - 94,876,522 (+) NCBI GRCr8 mRatBN7.2 1 85,720,812 - 85,749,079 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 85,720,812 - 85,749,078 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 91,137,685 - 91,165,886 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 99,603,840 - 99,632,046 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 92,895,953 - 92,924,165 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 88,922,346 - 88,950,560 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 88,922,433 - 88,950,559 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 90,077,799 - 90,106,425 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 85,414,492 - 85,444,233 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 85,516,160 - 85,522,343 (+) NCBI Celera 1 80,092,938 - 80,121,035 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nphs1 Rat 2-[4-[(E)-2-(6,8-dichloro-2-phenyl-2H-chromen-3-yl)ethenyl]phenyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane increases expression ISO Nphs1 (Mus musculus) 40902998 BD4 increases expression of Nphs1 mRNA in podocytes RGD Nphs1 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid increases expression ISO Nphs1 (Mus musculus) 40902998 Am580 increases expression of Nphs1 mRNA in podocytes RGD Nphs1 Rat 5-hydroxymethylfurfural decreases expression EXP 38599007 5-hydroxymethylfurfural co-treated with 3 and 4-dideoxyglucosone co-treated with Glyoxal co-treated with Methylglyoxal cotreated with 3-deoxyglucosone co-treated with Formaldehyde co-treated with acetaldehyde decreases expression of Nphs1 protein in kidneys RGD Nphs1 Rat all-trans-retinoic acid increases expression ISO Nphs1 (Mus musculus) 40902998 all-trans-retinoic acid increases expression of Nphs1 mRNA in podocytes RGD Nphs1 Rat angiotensin II multiple interactions ISO Nphs1 (Mus musculus) 38596324 angiotensin II inhibits reaction [fluvastatin increases expression of Nphs1 protein in kidney] RGD Nphs1 Rat fluvastatin increases expression ISO Nphs1 (Mus musculus) 38596324 fluvastatin increases expression of Nphs1 protein in kidney RGD Nphs1 Rat lipopolysaccharide decreases expression ISO Nphs1 (Mus musculus) 38599005 Lipopolysaccharide decreases expression of Nphs1 mRNA and protein in podocyte RGD Nphs1 Rat mycophenolate mofetil multiple interactions EXP 38596322 Mycophenolate mofetil inhibits reaction [streptozotocin decreases expression of Nphs1 mRNA and protein in kidney] RGD Nphs1 Rat olmesartan increases expression ISO Nphs1 (Mus musculus) 38599164 Olmesartan increases expression of Nphs1 protein in kidney RGD Nphs1 Rat retinoic acid increases expression ISO Nphs1 (Mus musculus) 38599009 Retinoic acid increases expression of Nphs1 mRNA in podocyte RGD Nphs1 Rat sodium chloride decreases expression ISO Nphs1 (Mus musculus) 38599161 Sodium chloride decreases expression of Nphs1 mRNA in hyperaldosteronic kidney RGD Nphs1 Rat spironolactone multiple interactions ISO Nphs1 (Mus musculus) 38599161 Spironolactone inhibits reaction [sodium chloride decreases expression of Nphs1 mRNA in hyperaldosteronic kidney] RGD Nphs1 Rat streptozocin decreases expression ISO Nphs1 (Mus musculus) 38596325 Streptozotocin decreases expression of Nphs1 mRNA and protein in renal glomerulus RGD Nphs1 Rat streptozocin decreases expression EXP 38596322 Streptozotocin decreases expression of Nphs1 mRNA and protein in kidney RGD Nphs1 Rat streptozocin decreases expression ISO Nphs1 (Mus musculus) 38599008 Streptozocin decreases expression of Nphs1 mRNA in kidney RGD Nphs1 Rat streptozocin decreases expression ISO Nphs1 (Mus musculus) 7241083 streptozotocin decreases expression of Nphs1 protein in kidney RGD Nphs1 Rat valsartan multiple interactions EXP 38596322 Valsartan inhibits reaction [streptozotocin decreases expression of Nphs1 mRNA and protein in kidney] RGD
2-[4-[(E)-2-(6,8-dichloro-2-phenyl-2H-chromen-3-yl)ethenyl]phenyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (ISO) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 5-hydroxymethylfurfural (EXP) all-trans-retinoic acid (ISO) angiotensin II (ISO) fluvastatin (ISO) lipopolysaccharide (ISO) mycophenolate mofetil (EXP) olmesartan (ISO) retinoic acid (ISO) sodium chloride (ISO) spironolactone (ISO) streptozocin (EXP,ISO) valsartan (EXP)
1.
Cloning and expression of the rat nephrin homolog.
Ahola H, etal., Am J Pathol 1999 Sep;155(3):907-13.
2.
Planar cell polarity pathway regulates actin rearrangement, cell shape, motility, and nephrin distribution in podocytes.
Babayeva S, etal., Am J Physiol Renal Physiol. 2011 Feb;300(2):F549-60. doi: 10.1152/ajprenal.00566.2009. Epub 2010 Jun 9.
3.
Nephrin and Neph1 co-localize at the podocyte foot process intercellular junction and form cis hetero-oligomers.
Barletta GM, etal., J Biol Chem 2003 May 23;278(21):19266-71. Epub 2003 Mar 19.
4.
Mutation spectrum in the nephrin gene (NPHS1) in congenital nephrotic syndrome.
Beltcheva O, etal., Hum Mutat 2001 May;17(5):368-73.
5.
Nephrin expression in the post-natal developing kidney in normotensive and hypertensive rats.
Bonnet F, etal., Clin Exp Hypertens 2002 Jul;24(5):371-81.
6.
Knockout of toll-like receptor-2 attenuates both the proinflammatory state of diabetes and incipient diabetic nephropathy.
Devaraj S, etal., Arterioscler Thromb Vasc Biol. 2011 Aug;31(8):1796-804. doi: 10.1161/ATVBAHA.111.228924. Epub 2011 May 26.
7.
BDNF: mRNA expression in urine cells of patients with chronic kidney disease and its role in kidney function.
Endlich N, etal., J Cell Mol Med. 2018 Nov;22(11):5265-5277. doi: 10.1111/jcmm.13762. Epub 2018 Aug 21.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Determinants of vascular permeability in the kidney glomerulus.
Hamano Y, etal., J Biol Chem 2002 Aug 23;277(34):31154-62. Epub 2002 May 30.
11.
Retinoic acid inhibits HIV-1-induced podocyte proliferation through the cAMP pathway.
He JC, etal., J Am Soc Nephrol. 2007 Jan;18(1):93-102. doi: 10.1681/ASN.2006070727. Epub 2006 Dec 20.
12.
Angiotensin II type 1 receptor blockade inhibits the development and progression of HIV-associated nephropathy in a mouse model.
Hiramatsu N, etal., J Am Soc Nephrol. 2007 Feb;18(2):515-27. doi: 10.1681/ASN.2006030217. Epub 2007 Jan 17.
13.
mTORC1 activation triggers the unfolded protein response in podocytes and leads to nephrotic syndrome.
Ito N, etal., Lab Invest. 2011 Nov;91(11):1584-95. doi: 10.1038/labinvest.2011.135. Epub 2011 Aug 29.
14.
SIRPalpha interacts with nephrin at the podocyte slit diaphragm.
Kajiho Y, etal., FEBS J. 2012 Sep;279(17):3010-21. doi: 10.1111/j.1742-4658.2012.08682.x. Epub 2012 Jul 23.
15.
Cloning of rat nephrin: expression in developing glomeruli and in proteinuric states.
Kawachi H, etal., Kidney Int 2000 May;57(5):1949-61.
16.
Molecular structure and function of the slit diaphragm: expression of nephrin in proteinuric states and in developing glomeruli.
Kawachi H, etal., Nephrol Dial Transplant 2002;17 Suppl 9:20-2.
17.
Expression of the slit-diaphragm protein, nephrin, in experimental diabetic nephropathy: differing effects of anti-proteinuric therapies.
Kelly DJ, etal., Nephrol Dial Transplant 2002 Jul;17(7):1327-32.
18.
Nephrin forms a complex with adherens junction proteins and CASK in podocytes and in Madin-Darby canine kidney cells expressing nephrin.
Lehtonen S, etal., Am J Pathol. 2004 Sep;165(3):923-36.
19.
Cell junction-associated proteins IQGAP1, MAGI-2, CASK, spectrins, and alpha-actinin are components of the nephrin multiprotein complex.
Lehtonen S, etal., Proc Natl Acad Sci U S A. 2005 Jul 12;102(28):9814-9. Epub 2005 Jul 1.
20.
Neph1 and nephrin interaction in the slit diaphragm is an important determinant of glomerular permeability.
Liu G, etal., J Clin Invest 2003 Jul;112(2):209-21.
21.
Kruppel-like factor 15 (KLF15) is a key regulator of podocyte differentiation.
Mallipattu SK, etal., J Biol Chem. 2012 Jun 1;287(23):19122-35. doi: 10.1074/jbc.M112.345983. Epub 2012 Apr 9.
22.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
23.
Renal toxicity mediated by glucose degradation products in a rat model of advanced renal failure.
Müller-Krebs S, etal., Eur J Clin Invest. 2008 May;38(5):296-305. doi: 10.1111/j.1365-2362.2008.01945.x. Epub 2008 Mar 16.
24.
Nephrin and podocin dissociate at the onset of proteinuria in experimental membranous nephropathy.
Nakatsue T, etal., Kidney Int. 2005 Jun;67(6):2239-53.
25.
Glomerular abundance of nephrin and podocin in experimental nephrotic syndrome: different effects of antiproteinuric therapies.
Nakhoul F, etal., Am J Physiol Renal Physiol. 2005 Oct;289(4):F880-90. Epub 2005 Jun 7.
26.
Messenger RNA expression of B7-1 and NPHS1 in urinary sediment could be useful to differentiate between minimal-change disease and focal segmental glomerulosclerosis in adult patients.
Navarro-Muñoz M, etal., Nephrol Dial Transplant. 2011 Dec;26(12):3914-23. doi: 10.1093/ndt/gfr128. Epub 2011 Mar 17.
27.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
28.
Chronic hyperaldosteronism in cryptochrome-null mice induces high-salt- and blood pressure-independent kidney damage in mice.
Nugrahaningsih DA, etal., Hypertens Res. 2014 Mar;37(3):202-9. doi: 10.1038/hr.2013.143. Epub 2013 Oct 10.
29.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
30.
Primary structure of mouse and rat nephrin cDNA and structure and expression of the mouse gene.
Putaala H, etal., J Am Soc Nephrol 2000 Jun;11(6):991-1001.
31.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
32.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
33.
Therapeutic potential of human induced pluripotent stem cells and renal progenitor cells in experimental chronic kidney disease.
Ribeiro PC, etal., Stem Cell Res Ther. 2020 Dec 9;11(1):530. doi: 10.1186/s13287-020-02060-4.
34.
Fluvastatin prevents podocyte injury in a murine model of HIV-associated nephropathy.
Sakurai N, etal., Nephrol Dial Transplant. 2009 Aug;24(8):2378-83. doi: 10.1093/ndt/gfp012. Epub 2009 Feb 2.
35.
Urine podocyte mRNAs mark progression of renal disease.
Sato Y, etal., J Am Soc Nephrol. 2009 May;20(5):1041-52. doi: 10.1681/ASN.2007121328. Epub 2009 Apr 23.
36.
Analysis of the genomic architecture of a complex trait locus in hypertensive rat models links Tmem63c to kidney damage.
Schulz A, etal., Elife. 2019 Mar 22;8. pii: 42068. doi: 10.7554/eLife.42068.
37.
Involvement of renal corpuscle microRNA expression on epithelial-to-mesenchymal transition in maternal low protein diet in adult programmed rats.
Sene Lde B, etal., PLoS One. 2013 Aug 19;8(8):e71310. doi: 10.1371/journal.pone.0071310. eCollection 2013.
38.
Tim-3 aggravates podocyte injury in diabetic nephropathy by promoting macrophage activation via the NF-κB/TNF-α pathway.
Yang H, etal., Mol Metab. 2019 May;23:24-36. doi: 10.1016/j.molmet.2019.02.007. Epub 2019 Feb 26.
39.
Macrophages directly mediate diabetic renal injury.
You H, etal., Am J Physiol Renal Physiol. 2013 Dec 15;305(12):F1719-27. doi: 10.1152/ajprenal.00141.2013. Epub 2013 Oct 30.
40.
Podocyte slit-diaphragm protein nephrin is linked to the actin cytoskeleton.
Yuan H, etal., Am J Physiol Renal Physiol 2002 Apr;282(4):F585-91.
41.
Effects of mycophenolate mofetil, valsartan and their combined therapy on preventing podocyte loss in early stage of diabetic nephropathy in rats.
Zhang Y, etal., Chin Med J (Engl). 2007 Jun 5;120(11):988-95.
42.
Novel retinoic acid receptor alpha agonists for treatment of kidney disease.
Zhong Y, etal., PLoS One. 2011;6(11):e27945. doi: 10.1371/journal.pone.0027945. Epub 2011 Nov 18.
Nphs1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 94,848,261 - 94,876,522 (+) NCBI GRCr8 mRatBN7.2 1 85,720,812 - 85,749,079 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 85,720,812 - 85,749,078 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 91,137,685 - 91,165,886 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 99,603,840 - 99,632,046 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 92,895,953 - 92,924,165 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 88,922,346 - 88,950,560 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 88,922,433 - 88,950,559 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 90,077,799 - 90,106,425 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 85,414,492 - 85,444,233 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 85,516,160 - 85,522,343 (+) NCBI Celera 1 80,092,938 - 80,121,035 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
NPHS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 35,862,915 - 35,869,357 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 35,825,964 - 35,869,287 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 36,316,274 - 36,342,895 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 41,008,697 - 41,034,579 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 41,008,696 - 41,034,579 NCBI Celera 19 33,029,746 - 33,057,068 (-) NCBI Celera Cytogenetic Map 19 q13.12 NCBI HuRef 19 32,820,999 - 32,848,201 (-) NCBI HuRef CHM1_1 19 36,355,097 - 36,361,471 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 38,408,667 - 38,415,111 (-) NCBI T2T-CHM13v2.0
Nphs1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 30,157,259 - 30,188,048 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 30,157,740 - 30,186,648 (+) Ensembl GRCm39 Ensembl GRCm38 7 30,458,207 - 30,488,623 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 30,458,315 - 30,487,223 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 31,245,077 - 31,273,628 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 30,168,976 - 30,195,476 (+) NCBI MGSCv36 mm8 MGSCv36 7 22,737,759 - 22,764,662 (+) NCBI MGSCv36 mm8 Celera 7 25,051,854 - 25,074,685 (+) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 18.36 NCBI
Nphs1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 2,714,419 - 2,734,830 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 2,715,728 - 2,734,174 (+) NCBI ChiLan1.0 ChiLan1.0
NPHS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 41,823,063 - 41,855,380 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 43,808,462 - 43,839,190 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 32,742,802 - 32,770,600 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 41,492,126 - 41,518,587 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 41,492,444 - 41,518,471 (-) Ensembl panpan1.1 panPan2
Nphs1
NPHS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 30,736,869 - 30,763,054 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 30,736,966 - 30,762,929 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 8,529,236 - 8,554,575 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nphs1
.
Predicted Target Of
Count of predictions: 503 Count of miRNA genes: 198 Interacting mature miRNAs: 242 Transcripts: ENSRNOT00000028358, ENSRNOT00000045212 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
D1Wox80
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 85,747,702 - 85,747,874 (+) MAPPER mRatBN7.2 Rnor_6.0 1 88,949,186 - 88,949,355 NCBI Rnor6.0 Rnor_5.0 1 90,105,051 - 90,105,220 UniSTS Rnor5.0 RGSC_v3.4 1 85,442,859 - 85,443,028 UniSTS RGSC3.4 Celera 1 80,119,661 - 80,119,830 UniSTS Cytogenetic Map 1 q22 UniSTS
PMC164293P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 85,724,699 - 85,724,877 (+) MAPPER mRatBN7.2 Rnor_6.0 1 88,926,319 - 88,926,496 NCBI Rnor6.0 Rnor_5.0 1 90,081,710 - 90,081,887 UniSTS Rnor5.0 RGSC_v3.4 1 85,418,379 - 85,418,556 UniSTS RGSC3.4 Celera 1 80,096,809 - 80,096,986 UniSTS Cytogenetic Map 1 q22 UniSTS
PMC164293P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 85,724,723 - 85,724,877 (+) MAPPER mRatBN7.2 Rnor_6.0 1 88,926,343 - 88,926,496 NCBI Rnor6.0 Rnor_5.0 1 90,081,734 - 90,081,887 UniSTS Rnor5.0 RGSC_v3.4 1 85,418,403 - 85,418,556 UniSTS RGSC3.4 Celera 1 80,096,833 - 80,096,986 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
29
111
63
62
31
25
31
6
170
77
91
45
53
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045212 ⟹ ENSRNOP00000049922
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 85,720,812 - 85,749,078 (+) Ensembl Rnor_6.0 Ensembl 1 88,922,433 - 88,950,559 (+) Ensembl
RefSeq Acc Id:
NM_022628 ⟹ NP_072150
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 94,848,261 - 94,876,522 (+) NCBI mRatBN7.2 1 85,720,812 - 85,749,079 (+) NCBI Rnor_6.0 1 88,922,433 - 88,950,560 (+) NCBI Rnor_5.0 1 90,077,799 - 90,106,425 (+) NCBI RGSC_v3.4 1 85,414,492 - 85,444,233 (+) RGD Celera 1 80,092,938 - 80,121,035 (+) RGD
Sequence:
CAAAGTGAGCTCACCCTGGGTCCAAGAAATGTTCCCATGCTGTGTCTGACGCTTTTGGCTTTCTGGGTTCATGGAACTGCTGGACCCAGCACAGCTGGTGAGCTCTGAGTGCCTGTGAGTGGGTGAGA
hide sequence
RefSeq Acc Id:
NP_072150 ⟸ NM_022628
- Peptide Label:
precursor
- UniProtKB:
Q9QXX7 (UniProtKB/Swiss-Prot), Q9JIX2 (UniProtKB/Swiss-Prot), Q9R044 (UniProtKB/Swiss-Prot)
- Sequence:
MGAKRVTVRGARTSPIHRTSSLTPLLLMGMLTSGLAESPVPTSAPQGFWALSENLTAVEGTTVKLWCGVRAPGSVVQWAKDGLLLGPNPKMPGFPRYSLEGDRAKGEFHLLIEACDLSDDAEYECQVG
hide sequence
Ensembl Acc Id:
ENSRNOP00000049922 ⟸ ENSRNOT00000045212
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-04
Nphs1
NPHS1 adhesion molecule, nephrin
Nphs1
NPHS1 nephrin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-17
Nphs1
NPHS1 nephrin
Nphs1
nephrosis 1, congenital, Finnish type (nephrin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-05
Nphs1
nephrosis 1, congenital, Finnish type (nephrin)
Nphs1
nephrosis 1, congenital, Finnish type
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-07-06
Nphs1
nephrosis 1, congenital, Finnish type
Nphs1
nephrosis 1 homolog (human)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-11-06
Nphs1
nephrosis 1 homolog (human)
Nphs1
nephrosis 1 homolog, nephrin (human)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Nphs1
nephrosis 1 homolog, nephrin (human)
nephrin
Name updated
1299863 APPROVED
2002-08-07
Nphs1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
human homolog is mutated in congenital nephrotic syndrome of the Finnish type
633453
