Symbol:
Brca2
Name:
BRCA2, DNA repair associated
RGD ID:
2219
Description:
Enables single-stranded DNA binding activity. Involved in several processes, including homologous chromosome orientation in meiotic metaphase I; response to estradiol; and spermatogenesis. Predicted to be located in several cellular components, including centrosome; chromosome, telomeric region; and nuclear lumen. Predicted to be part of BRCA2-MAGE-D1 complex; DNA repair complex; and nuclear ubiquitin ligase complex. Predicted to be active in nucleus. Used to study atrophy of testis; cancer; cataract; infertility; and osteosarcoma. Biomarker of ductal carcinoma in situ and prostate cancer. Human ortholog(s) of this gene implicated in several diseases, including Fanconi anemia (multiple); esophagus squamous cell carcinoma; hereditary breast ovarian cancer syndrome; melanoma (multiple); and reproductive organ cancer (multiple). Orthologous to human BRCA2 (BRCA2 DNA repair associated); PARTICIPATES IN homologous recombination pathway of double-strand break repair; ceramide signaling pathway; pancreatic cancer pathway; INTERACTS WITH 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
breast cancer 2; breast cancer 2, early onset; breast cancer 2, mutation 1, University of Wisconsin-Madison; breast cancer susceptibility protein 2; breast cancer type 2 susceptibility protein homolog; fanconi anemia group D1 protein homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BRCA2 (BRCA2 DNA repair associated) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Brca2 (breast cancer 2, early onset) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Brca2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BRCA2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BRCA2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Brca2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BRCA2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BRCA2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Brca2 (BRCA2 DNA repair associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZFAND2A (zinc finger AN1-type containing 2A) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Brca2 (breast cancer 2, early onset)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BRCA2 (BRCA2 DNA repair associated)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
brca2 (BRCA2 DNA repair associated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
brca2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Allele / Splice:
Brca2m1Uwm
Genetic Models:
SD-Brca2m1Uwm
Is Marker For:
Strains:
SD
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 4,895,092 - 4,939,340 (+) NCBI GRCr8 mRatBN7.2 12 59,492 - 103,789 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 59,819 - 100,567 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 628,555 - 669,267 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 1,150,791 - 1,191,504 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 50,374 - 91,100 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 503,660 - 544,754 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 504,007 - 544,748 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 490,733 - 535,090 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 4,282,952 - 4,323,693 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 4,282,951 - 4,323,693 NCBI Celera 12 1,769,467 - 1,810,212 (+) NCBI Celera Cytogenetic Map 12 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Brca2 Rat (-)-demecolcine decreases expression ISO BRCA2 (Homo sapiens) 6480464 Demecolcine results in decreased expression of BRCA2 mRNA CTD PMID:23649840 Brca2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BRCA2 mRNA CTD PMID:22079256 Brca2 Rat (R)-lipoic acid multiple interactions ISO Brca2 (Mus musculus) 6480464 Thioctic Acid inhibits the reaction [Potassium Dichromate results in decreased expression of BRCA2 mRNA] CTD PMID:23608068 Brca2 Rat (S)-naringenin increases expression ISO BRCA2 (Homo sapiens) 6480464 naringenin results in increased expression of BRCA2 mRNA CTD PMID:36235125 Brca2 Rat (S)-naringenin multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in increased expression of BRCA2 mRNA and [naringenin metabolite co-treated with bisphenol A] results in increased expression of BRCA2 mRNA CTD PMID:36235125 Brca2 Rat 1,2-dichloroethane decreases expression ISO Brca2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of BRCA2 mRNA CTD PMID:28960355 Brca2 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression EXP 6480464 Citalopram results in decreased expression of BRCA2 mRNA CTD PMID:28467792 Brca2 Rat 17alpha-ethynylestradiol increases expression ISO Brca2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of BRCA2 mRNA CTD PMID:17942748 Brca2 Rat 17alpha-ethynylestradiol multiple interactions ISO Brca2 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in increased expression of BRCA2 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BRCA2 mRNA CTD PMID:17942748 and PMID:37844793 Brca2 Rat 17beta-estradiol increases expression ISO BRCA2 (Homo sapiens) 6480464 Estradiol results in increased expression of BRCA2 mRNA CTD PMID:19167446 Brca2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO BRCA2 (Homo sapiens) 6480464 Metribolone results in increased expression of BRCA2 mRNA CTD PMID:17010196 Brca2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Brca2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Brca2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Brca2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Brca2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Brca2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BRCA2 mRNA CTD PMID:17942748 Brca2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BRCA2 mRNA CTD PMID:33387578 Brca2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO BRCA2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of BRCA2 mRNA CTD PMID:22574217 Brca2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Brca2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BRCA2 mRNA CTD PMID:21570461 Brca2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Brca2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BRCA2 mRNA CTD PMID:17942748 Brca2 Rat 2-bromohexadecanoic acid multiple interactions ISO BRCA2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of BRCA2 protein] CTD PMID:38195004 Brca2 Rat 2-palmitoylglycerol increases expression ISO BRCA2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of BRCA2 mRNA CTD PMID:37199045 Brca2 Rat 4-hydroxyphenyl retinamide decreases expression ISO BRCA2 (Homo sapiens) 6480464 Fenretinide results in decreased expression of BRCA2 mRNA CTD PMID:16570282 Brca2 Rat abexinostat decreases expression ISO BRCA2 (Homo sapiens) 6480464 abexinostat results in decreased expression of BRCA2 mRNA CTD PMID:18042714 Brca2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BRCA2 mRNA CTD PMID:31881176 Brca2 Rat aflatoxin B1 affects expression ISO BRCA2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of BRCA2 protein CTD PMID:20106945 Brca2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of BRCA2 mRNA CTD PMID:23630614 Brca2 Rat aflatoxin B1 increases expression ISO Brca2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of BRCA2 mRNA CTD PMID:19770486 Brca2 Rat all-trans-retinoic acid affects expression ISO BRCA2 (Homo sapiens) 6480464 Tretinoin affects the expression of BRCA2 mRNA CTD PMID:15498508 Brca2 Rat all-trans-retinoic acid decreases expression ISO BRCA2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of BRCA2 mRNA CTD PMID:15498508 and PMID:33167477 Brca2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BRCA2 mRNA CTD PMID:16483693 Brca2 Rat antirheumatic drug decreases expression ISO BRCA2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of BRCA2 mRNA CTD PMID:24449571 Brca2 Rat Aroclor 1254 decreases expression ISO Brca2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of BRCA2 mRNA CTD PMID:23650126 Brca2 Rat arsenite(3-) multiple interactions ISO BRCA2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to BRCA2 mRNA] CTD PMID:32406909 Brca2 Rat arsenous acid decreases expression ISO BRCA2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of BRCA2 mRNA CTD PMID:20471514 Brca2 Rat arsenous acid multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Bortezomib] results in increased expression of BRCA2 mRNA CTD PMID:25913414 Brca2 Rat asbestos affects response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 alternative form affects the susceptibility to Asbestos CTD PMID:28687356 Brca2 Rat azathioprine decreases expression ISO BRCA2 (Homo sapiens) 6480464 Azathioprine results in decreased expression of BRCA2 mRNA CTD PMID:22623647 Brca2 Rat benzene increases response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 gene SNP results in increased susceptibility to Benzene CTD PMID:16728435 Brca2 Rat benzene affects expression ISO BRCA2 (Homo sapiens) 6480464 Benzene affects the expression of BRCA2 mRNA CTD PMID:16188086 Brca2 Rat benzo[a]pyrene increases expression ISO BRCA2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BRCA2 mRNA CTD PMID:28461126 and PMID:32234424 Brca2 Rat benzo[a]pyrene affects methylation ISO BRCA2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BRCA2 promoter CTD PMID:27901495 Brca2 Rat benzo[a]pyrene decreases expression ISO Brca2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BRCA2 mRNA CTD PMID:20504355 and PMID:22228805 Brca2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO BRCA2 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Brca2 Rat Benzo[ghi]perylene increases expression ISO BRCA2 (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of BRCA2 mRNA CTD PMID:31518672 Brca2 Rat benzophenanthridine decreases expression ISO BRCA2 (Homo sapiens) 6480464 Benzophenanthridines analog results in decreased expression of BRCA2 mRNA CTD PMID:23117580 Brca2 Rat bis(2-chloroethyl) sulfide multiple interactions ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein inhibits the reaction [Mustard Gas affects the localization of RAD51 protein] more ... CTD PMID:20435105 Brca2 Rat bis(2-chloroethyl) sulfide decreases response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein results in decreased susceptibility to Mustard Gas CTD PMID:20435105 Brca2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Brca2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BRCA2 mRNA CTD PMID:36423848 Brca2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Brca2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of BRCA2 mRNA CTD PMID:33754040 Brca2 Rat bisphenol A increases expression ISO BRCA2 (Homo sapiens) 6480464 bisphenol A results in increased expression of BRCA2 mRNA and bisphenol A results in increased expression of BRCA2 protein CTD PMID:22576693 and PMID:25933419 Brca2 Rat bisphenol A decreases expression ISO BRCA2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of BRCA2 mRNA CTD PMID:36982678 and PMID:38354435 Brca2 Rat bisphenol A decreases expression ISO Brca2 (Mus musculus) 6480464 bisphenol A results in decreased expression of BRCA2 mRNA CTD PMID:32156529 Brca2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BRCA2 gene CTD PMID:28505145 Brca2 Rat bisphenol A multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [bisphenol A co-treated with Quercetin] results in decreased expression of BRCA2 mRNA more ... CTD PMID:25933419 more ... Brca2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BRCA2 mRNA CTD PMID:25181051 Brca2 Rat bortezomib decreases expression ISO BRCA2 (Homo sapiens) 6480464 Bortezomib results in decreased expression of BRCA2 mRNA CTD PMID:21917757 Brca2 Rat bortezomib multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [arsenic trioxide co-treated with Bortezomib] results in increased expression of BRCA2 mRNA CTD PMID:25913414 Brca2 Rat butanal decreases expression ISO BRCA2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of BRCA2 mRNA CTD PMID:26079696 Brca2 Rat cadmium atom multiple interactions ISO BRCA2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of BRCA2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of BRCA2 protein CTD PMID:38195004 Brca2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of BRCA2 promoter CTD PMID:22457795 Brca2 Rat cadmium dichloride multiple interactions ISO BRCA2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of BRCA2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of BRCA2 protein CTD PMID:38195004 Brca2 Rat cadmium dichloride increases expression ISO BRCA2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of BRCA2 mRNA CTD PMID:12160620 and PMID:26472689 Brca2 Rat cadmium dichloride multiple interactions ISO Brca2 (Mus musculus) 6480464 MT1 affects the reaction [Cadmium Chloride results in decreased expression of BRCA2 mRNA] and MT2 affects the reaction [Cadmium Chloride results in decreased expression of BRCA2 mRNA] CTD PMID:11958953 Brca2 Rat cadmium dichloride decreases expression ISO Brca2 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of BRCA2 mRNA CTD PMID:11958953 Brca2 Rat caffeine affects phosphorylation ISO BRCA2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of BRCA2 protein CTD PMID:35688186 Brca2 Rat calcitriol decreases expression ISO BRCA2 (Homo sapiens) 6480464 Calcitriol results in decreased expression of BRCA2 mRNA CTD PMID:21592394 Brca2 Rat calcitriol multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of BRCA2 mRNA CTD PMID:21592394 Brca2 Rat camptothecin decreases expression ISO BRCA2 (Homo sapiens) 6480464 Camptothecin results in decreased expression of BRCA2 mRNA CTD PMID:10344722 Brca2 Rat cannabidiol multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone] inhibits the reaction [Cannabidiol results in decreased expression of BRCA2 mRNA] and Cannabidiol inhibits the reaction [[Oxygen co-treated with Ozone] results in increased expression of BRCA2 mRNA] CTD PMID:32992648 Brca2 Rat cannabidiol decreases expression ISO BRCA2 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of BRCA2 mRNA CTD PMID:32992648 and PMID:36519830 Brca2 Rat carbon nanotube increases expression ISO Brca2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of BRCA2 mRNA CTD PMID:25554681 Brca2 Rat chlorpyrifos decreases expression ISO Brca2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of BRCA2 mRNA CTD PMID:37019170 Brca2 Rat choline multiple interactions ISO Brca2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of BRCA2 gene CTD PMID:20938992 Brca2 Rat chromium(6+) affects expression ISO Brca2 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of BRCA2 mRNA CTD PMID:28472532 Brca2 Rat chromium(6+) affects localization ISO BRCA2 (Homo sapiens) 6480464 chromium hexavalent ion affects the localization of BRCA2 protein CTD PMID:27449664 Brca2 Rat cisplatin decreases response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein results in decreased susceptibility to Cisplatin and BRCA2 results in decreased susceptibility to Cisplatin CTD PMID:21385444 and PMID:21633166 Brca2 Rat cisplatin multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of BRCA2 mRNA CTD PMID:30871063 Brca2 Rat cisplatin increases expression ISO BRCA2 (Homo sapiens) 6480464 Cisplatin results in increased expression of BRCA2 mRNA CTD PMID:27594783 Brca2 Rat citalopram decreases expression EXP 6480464 Citalopram results in decreased expression of BRCA2 mRNA CTD PMID:28467792 Brca2 Rat coumestrol multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Brca2 Rat coumestrol increases expression ISO BRCA2 (Homo sapiens) 6480464 Coumestrol results in increased expression of BRCA2 mRNA CTD PMID:19167446 Brca2 Rat CU-O LINKAGE increases expression ISO BRCA2 (Homo sapiens) 6480464 cupric oxide results in increased expression of BRCA2 mRNA CTD PMID:32285662 Brca2 Rat CX-5461 affects response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein affects the susceptibility to CX 5461 CTD PMID:28211448 Brca2 Rat CX-5461 affects response to substance ISO Brca2 (Mus musculus) 6480464 BRCA2 protein affects the susceptibility to CX 5461 CTD PMID:28211448 Brca2 Rat CX-5461 multiple interactions ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein affects the reaction [CX 5461 results in increased expression of TP53BP1 protein] and BRCA2 protein affects the reaction [CX 5461 results in increased phosphorylation of RPA2 protein] CTD PMID:28211448 Brca2 Rat cycloheximide multiple interactions ISO BRCA2 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Nitrogen Mustard Compounds results in decreased expression of BRCA2 mRNA] CTD PMID:10344722 Brca2 Rat cyclosporin A decreases expression ISO BRCA2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BRCA2 mRNA CTD PMID:20106945 more ... Brca2 Rat cylindrospermopsin decreases expression ISO BRCA2 (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of BRCA2 mRNA CTD PMID:23726867 Brca2 Rat cytarabine increases expression ISO BRCA2 (Homo sapiens) 6480464 Cytarabine results in increased expression of BRCA2 mRNA CTD PMID:19194470 Brca2 Rat Decamethylcyclopentasiloxane decreases expression ISO BRCA2 (Homo sapiens) 6480464 decamethylcyclopentasiloxane results in decreased expression of BRCA2 mRNA CTD PMID:27601420 Brca2 Rat diarsenic trioxide multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Bortezomib] results in increased expression of BRCA2 mRNA CTD PMID:25913414 Brca2 Rat diarsenic trioxide decreases expression ISO BRCA2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of BRCA2 mRNA CTD PMID:20471514 Brca2 Rat dibenzofuran decreases expression EXP 6480464 dibenzofuran analog results in decreased expression of BRCA2 mRNA CTD PMID:20566336 Brca2 Rat dibutyl phthalate decreases expression ISO Brca2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of BRCA2 mRNA CTD PMID:17361019 more ... Brca2 Rat diclofenac multiple interactions ISO Brca2 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in increased expression of BRCA2 mRNA CTD PMID:37844793 Brca2 Rat dinaciclib decreases expression ISO BRCA2 (Homo sapiens) 6480464 dinaciclib results in decreased expression of BRCA2 protein CTD PMID:27880910 Brca2 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of BRCA2 mRNA CTD PMID:26476374 Brca2 Rat dioxygen multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone] inhibits the reaction [Cannabidiol results in decreased expression of BRCA2 mRNA] more ... CTD PMID:32992648 Brca2 Rat dioxygen decreases expression ISO BRCA2 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of BRCA2 mRNA CTD PMID:26516004 and PMID:38909692 Brca2 Rat dioxygen multiple interactions EXP 6480464 Quercetin inhibits the reaction [Oxygen deficiency results in increased expression of BRCA2 mRNA] CTD PMID:26476374 Brca2 Rat disodium selenite decreases expression ISO BRCA2 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of BRCA2 mRNA CTD PMID:10344722 Brca2 Rat doxorubicin decreases expression ISO BRCA2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BRCA2 mRNA CTD PMID:10344722 and PMID:30031762 Brca2 Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of BRCA2 protein CTD PMID:28818578 Brca2 Rat doxorubicin multiple interactions ISO Brca2 (Mus musculus) 6480464 Lovastatin inhibits the reaction [Doxorubicin results in increased expression of BRCA2 mRNA] CTD PMID:22712078 Brca2 Rat doxorubicin increases expression ISO Brca2 (Mus musculus) 6480464 Doxorubicin results in increased expression of BRCA2 mRNA CTD PMID:22712078 Brca2 Rat endosulfan increases expression ISO BRCA2 (Homo sapiens) 6480464 Endosulfan results in increased expression of BRCA2 protein CTD PMID:29705383 Brca2 Rat endosulfan decreases expression ISO BRCA2 (Homo sapiens) 6480464 Endosulfan results in decreased expression of BRCA2 mRNA CTD PMID:30090376 Brca2 Rat endosulfan multiple interactions ISO BRCA2 (Homo sapiens) 6480464 2-morpholin-4-yl-6-thianthren-1-yl-pyran-4-one inhibits the reaction [Endosulfan affects the expression of BRCA2 mRNA] CTD PMID:29705383 Brca2 Rat endosulfan affects expression ISO BRCA2 (Homo sapiens) 6480464 Endosulfan affects the expression of BRCA2 mRNA CTD PMID:29705383 Brca2 Rat Enterolactone multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of BRCA2 mRNA CTD PMID:19167446 Brca2 Rat ethanol decreases expression ISO Brca2 (Mus musculus) 6480464 Ethanol results in decreased expression of BRCA2 mRNA CTD PMID:35149083 Brca2 Rat folic acid multiple interactions ISO Brca2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of BRCA2 gene CTD PMID:20938992 Brca2 Rat folic acid decreases expression ISO BRCA2 (Homo sapiens) 6480464 Folic Acid results in decreased expression of BRCA2 mRNA CTD PMID:21867686 Brca2 Rat furan increases expression EXP 6480464 furan results in increased expression of BRCA2 mRNA CTD PMID:20562052 and PMID:22079235 Brca2 Rat genistein increases expression ISO BRCA2 (Homo sapiens) 6480464 Genistein results in increased expression of BRCA2 mRNA and Genistein results in increased expression of BRCA2 protein CTD PMID:16434996 Brca2 Rat genistein multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [indole-3-carbinol co-treated with Genistein] results in increased expression of BRCA2 protein CTD PMID:16434996 Brca2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BRCA2 mRNA CTD PMID:33387578 Brca2 Rat geraniol decreases expression ISO BRCA2 (Homo sapiens) 6480464 geraniol results in decreased expression of BRCA2 mRNA CTD PMID:27683099 Brca2 Rat glycidyl methacrylate decreases expression ISO BRCA2 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of BRCA2 protein CTD PMID:36641056 Brca2 Rat gold atom multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of BRCA2 mRNA CTD PMID:28433809 Brca2 Rat gold atom decreases expression ISO BRCA2 (Homo sapiens) 6480464 Gold analog results in decreased expression of BRCA2 mRNA CTD PMID:36057382 Brca2 Rat gold(0) multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of BRCA2 mRNA CTD PMID:28433809 Brca2 Rat gold(0) decreases expression ISO BRCA2 (Homo sapiens) 6480464 Gold analog results in decreased expression of BRCA2 mRNA CTD PMID:36057382 Brca2 Rat hexamethylcyclotrisiloxane decreases expression ISO BRCA2 (Homo sapiens) 6480464 hexamethylcyclotrisiloxane results in decreased expression of BRCA2 mRNA CTD PMID:27601420 Brca2 Rat ibuprofen multiple interactions ISO Brca2 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in increased expression of BRCA2 mRNA CTD PMID:37844793 Brca2 Rat imiquimod decreases expression ISO Brca2 (Mus musculus) 6480464 imiquimod results in decreased expression of BRCA2 mRNA CTD PMID:21878529 Brca2 Rat indole-3-methanol increases expression ISO BRCA2 (Homo sapiens) 6480464 indole-3-carbinol results in increased expression of BRCA2 mRNA and indole-3-carbinol results in increased expression of BRCA2 protein CTD PMID:16434996 Brca2 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of BRCA2 mRNA CTD PMID:21396975 Brca2 Rat indole-3-methanol multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [indole-3-carbinol co-treated with Genistein] results in increased expression of BRCA2 protein CTD PMID:16434996 Brca2 Rat iron dichloride decreases expression ISO BRCA2 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of BRCA2 mRNA CTD PMID:35984750 Brca2 Rat L-methionine multiple interactions ISO Brca2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of BRCA2 gene CTD PMID:20938992 Brca2 Rat Lasiocarpine multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of BRCA2 mRNA CTD PMID:33884520 Brca2 Rat Lasiocarpine increases expression ISO BRCA2 (Homo sapiens) 6480464 lasiocarpine results in increased expression of BRCA2 mRNA CTD PMID:32234424 Brca2 Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of BRCA2 protein CTD PMID:28086193 Brca2 Rat lipoic acid multiple interactions ISO Brca2 (Mus musculus) 6480464 Thioctic Acid inhibits the reaction [Potassium Dichromate results in decreased expression of BRCA2 mRNA] CTD PMID:23608068 Brca2 Rat lipopolysaccharide multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of BRCA2 mRNA CTD PMID:35811015 Brca2 Rat lithocholic acid decreases response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein results in decreased susceptibility to Lithocholic Acid CTD PMID:20028873 Brca2 Rat lovastatin multiple interactions ISO Brca2 (Mus musculus) 6480464 Lovastatin inhibits the reaction [Doxorubicin results in increased expression of BRCA2 mRNA] CTD PMID:22712078 Brca2 Rat lucanthone decreases expression ISO BRCA2 (Homo sapiens) 6480464 Lucanthone results in decreased expression of BRCA2 mRNA CTD PMID:21148553 Brca2 Rat methyl methanesulfonate increases expression ISO BRCA2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of BRCA2 mRNA CTD PMID:23649840 Brca2 Rat methylmercury chloride decreases expression ISO BRCA2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BRCA2 mRNA CTD PMID:28001369 Brca2 Rat methylseleninic acid increases expression ISO BRCA2 (Homo sapiens) 6480464 methylselenic acid results in increased expression of BRCA2 mRNA CTD PMID:12517777 Brca2 Rat monocrotaline multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which affects the expression of BRCA2 mRNA CTD PMID:33884520 Brca2 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO BRCA2 (Homo sapiens) 6480464 N more ... CTD PMID:33645215 Brca2 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO BRCA2 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of BRCA2 mRNA CTD PMID:12634122 Brca2 Rat N-nitrosodiethylamine increases expression ISO Brca2 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of BRCA2 mRNA CTD PMID:17854601 Brca2 Rat N-nitrosodiethylamine multiple interactions ISO Brca2 (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of BRCA2 mRNA] CTD PMID:17854601 Brca2 Rat nitrogen mustard multiple interactions ISO BRCA2 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Nitrogen Mustard Compounds results in decreased expression of BRCA2 mRNA] CTD PMID:10344722 Brca2 Rat nitrogen mustard increases expression ISO BRCA2 (Homo sapiens) 6480464 Nitrogen Mustard Compounds results in increased expression of BRCA2 mRNA CTD PMID:27342729 Brca2 Rat nitrogen mustard decreases expression ISO BRCA2 (Homo sapiens) 6480464 Nitrogen Mustard Compounds results in decreased expression of BRCA2 mRNA CTD PMID:10344722 Brca2 Rat O-methyleugenol decreases expression EXP 6480464 methyleugenol results in decreased expression of BRCA2 mRNA CTD PMID:26011634 Brca2 Rat octamethylcyclotetrasiloxane decreases expression ISO BRCA2 (Homo sapiens) 6480464 octamethylcyclotetrasiloxane results in decreased expression of BRCA2 mRNA CTD PMID:27601420 Brca2 Rat olaparib affects response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 affects the susceptibility to olaparib CTD PMID:21633166 Brca2 Rat ozone multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone] inhibits the reaction [Cannabidiol results in decreased expression of BRCA2 mRNA] more ... CTD PMID:32992648 Brca2 Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Particulate Matter co-treated with Ozone]] which results in increased expression of BRCA2 mRNA CTD PMID:36423397 Brca2 Rat paracetamol increases expression ISO BRCA2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of BRCA2 mRNA CTD PMID:22230336 Brca2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BRCA2 mRNA CTD PMID:33387578 Brca2 Rat paraquat decreases expression ISO Brca2 (Mus musculus) 6480464 Paraquat results in decreased expression of BRCA2 mRNA CTD PMID:28012437 Brca2 Rat PCB138 multiple interactions ISO Brca2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Brca2 Rat phenethyl isothiocyanate decreases expression ISO BRCA2 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of BRCA2 mRNA CTD PMID:26678675 Brca2 Rat phenobarbital affects expression ISO Brca2 (Mus musculus) 6480464 Phenobarbital affects the expression of BRCA2 mRNA CTD PMID:19136022 Brca2 Rat pirinixic acid affects expression ISO Brca2 (Mus musculus) 6480464 pirinixic acid affects the expression of BRCA2 mRNA CTD PMID:19136022 Brca2 Rat pirinixic acid increases expression ISO Brca2 (Mus musculus) 6480464 pirinixic acid results in increased expression of BRCA2 mRNA CTD PMID:23811191 Brca2 Rat potassium chromate multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BRCA2 mRNA CTD PMID:22079256 Brca2 Rat potassium chromate decreases expression ISO BRCA2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BRCA2 mRNA CTD PMID:22079256 Brca2 Rat potassium dichromate decreases expression ISO Brca2 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of BRCA2 mRNA CTD PMID:23608068 Brca2 Rat potassium dichromate multiple interactions ISO Brca2 (Mus musculus) 6480464 Thioctic Acid inhibits the reaction [Potassium Dichromate results in decreased expression of BRCA2 mRNA] CTD PMID:23608068 Brca2 Rat pregnenolone 16alpha-carbonitrile multiple interactions ISO Brca2 (Mus musculus) 6480464 [1 more ... CTD PMID:23626729 Brca2 Rat promethazine decreases expression EXP 6480464 Promethazine results in decreased expression of BRCA2 mRNA CTD PMID:26011634 Brca2 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Oxygen deficiency results in increased expression of BRCA2 mRNA] CTD PMID:26476374 Brca2 Rat quercetin multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [bisphenol A co-treated with Quercetin] results in decreased expression of BRCA2 mRNA CTD PMID:36982678 Brca2 Rat quercetin decreases expression ISO BRCA2 (Homo sapiens) 6480464 Quercetin results in decreased expression of BRCA2 mRNA CTD PMID:36982678 Brca2 Rat quercetin decreases expression ISO Brca2 (Mus musculus) 6480464 Quercetin results in decreased expression of BRCA2 mRNA CTD PMID:25862958 Brca2 Rat quercetin increases expression ISO BRCA2 (Homo sapiens) 6480464 Quercetin results in increased expression of BRCA2 mRNA CTD PMID:15309432 Brca2 Rat resveratrol increases expression ISO BRCA2 (Homo sapiens) 6480464 resveratrol results in increased expression of BRCA2 mRNA CTD PMID:15149879 Brca2 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of BRCA2 mRNA CTD PMID:33775663 Brca2 Rat resveratrol decreases expression ISO BRCA2 (Homo sapiens) 6480464 resveratrol results in decreased expression of BRCA2 mRNA CTD PMID:25667456 Brca2 Rat resveratrol multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of BRCA2 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of BRCA2 mRNA CTD PMID:19167446 and PMID:23557933 Brca2 Rat resveratrol affects expression EXP 6480464 resveratrol affects the expression of BRCA2 mRNA CTD PMID:15748624 Brca2 Rat riddelliine multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of riddelliine] which results in decreased expression of BRCA2 mRNA CTD PMID:33884520 Brca2 Rat rotenone increases expression ISO BRCA2 (Homo sapiens) 6480464 Rotenone results in increased expression of BRCA2 mRNA CTD PMID:18191903 Brca2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of BRCA2 mRNA CTD PMID:35811015 Brca2 Rat sodium arsenite affects expression ISO Brca2 (Mus musculus) 6480464 sodium arsenite affects the expression of BRCA2 mRNA CTD PMID:16507464 Brca2 Rat sodium arsenite increases expression ISO BRCA2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BRCA2 mRNA CTD PMID:12760830 and PMID:29301061 Brca2 Rat succimer multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of BRCA2 mRNA CTD PMID:26378955 Brca2 Rat sunitinib decreases expression ISO BRCA2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of BRCA2 mRNA CTD PMID:31533062 Brca2 Rat tamibarotene affects expression ISO BRCA2 (Homo sapiens) 6480464 tamibarotene affects the expression of BRCA2 mRNA CTD PMID:15498508 Brca2 Rat tamibarotene decreases expression ISO BRCA2 (Homo sapiens) 6480464 tamibarotene results in decreased expression of BRCA2 mRNA CTD PMID:15498508 Brca2 Rat temozolomide decreases response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 protein results in decreased susceptibility to temozolomide CTD PMID:20028873 Brca2 Rat testosterone multiple interactions ISO BRCA2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of BRCA2 mRNA CTD PMID:21592394 Brca2 Rat testosterone decreases expression ISO BRCA2 (Homo sapiens) 6480464 Testosterone results in decreased expression of BRCA2 mRNA CTD PMID:21592394 Brca2 Rat thapsigargin increases expression ISO BRCA2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of BRCA2 mRNA and Thapsigargin results in increased expression of BRCA2 protein CTD PMID:16434996 Brca2 Rat thimerosal increases expression ISO BRCA2 (Homo sapiens) 6480464 Thimerosal results in increased expression of BRCA2 mRNA CTD PMID:27188386 Brca2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of BRCA2 mRNA CTD PMID:34492290 Brca2 Rat trichostatin A decreases expression ISO BRCA2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of BRCA2 mRNA CTD PMID:23770000 Brca2 Rat trimellitic anhydride increases expression ISO Brca2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of BRCA2 mRNA CTD PMID:19042947 Brca2 Rat triphenyl phosphate affects expression ISO BRCA2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BRCA2 mRNA CTD PMID:37042841 Brca2 Rat triptonide affects expression ISO Brca2 (Mus musculus) 6480464 triptonide affects the expression of BRCA2 mRNA CTD PMID:33045310 Brca2 Rat trovafloxacin decreases expression ISO Brca2 (Mus musculus) 6480464 trovafloxacin results in decreased expression of BRCA2 mRNA CTD PMID:35537566 Brca2 Rat tunicamycin increases expression ISO BRCA2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of BRCA2 protein CTD PMID:16434996 Brca2 Rat valproic acid affects expression ISO BRCA2 (Homo sapiens) 6480464 Valproic Acid affects the expression of BRCA2 mRNA CTD PMID:25979313 Brca2 Rat valproic acid decreases expression ISO BRCA2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of BRCA2 mRNA CTD PMID:23179753 and PMID:27188386 Brca2 Rat valproic acid increases expression ISO Brca2 (Mus musculus) 6480464 Valproic Acid results in increased expression of BRCA2 mRNA CTD PMID:24913804 Brca2 Rat valproic acid decreases expression ISO Brca2 (Mus musculus) 6480464 Valproic Acid results in decreased expression of BRCA2 mRNA CTD PMID:24913804 Brca2 Rat veliparib affects response to substance ISO BRCA2 (Homo sapiens) 6480464 BRCA2 affects the susceptibility to veliparib CTD PMID:21633166 Brca2 Rat vorinostat increases expression ISO BRCA2 (Homo sapiens) 6480464 vorinostat results in increased expression of BRCA2 mRNA CTD PMID:27188386 Brca2 Rat zinc atom decreases expression ISO BRCA2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of BRCA2 mRNA CTD PMID:18356318 Brca2 Rat zinc(0) decreases expression ISO BRCA2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of BRCA2 mRNA CTD PMID:18356318 Brca2 Rat zoledronic acid increases expression ISO BRCA2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of BRCA2 mRNA CTD PMID:20977926
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) (R)-lipoic acid (ISO) (S)-naringenin (ISO) 1,2-dichloroethane (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 2-palmitoylglycerol (ISO) 4-hydroxyphenyl retinamide (ISO) abexinostat (ISO) acetamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) azathioprine (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[ghi]perylene (ISO) benzophenanthridine (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) camptothecin (ISO) cannabidiol (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) citalopram (EXP) coumestrol (ISO) CU-O LINKAGE (ISO) CX-5461 (ISO) cycloheximide (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) cytarabine (ISO) Decamethylcyclopentasiloxane (ISO) diarsenic trioxide (ISO) dibenzofuran (EXP) dibutyl phthalate (ISO) diclofenac (ISO) dinaciclib (ISO) dioxygen (EXP,ISO) disodium selenite (ISO) doxorubicin (EXP,ISO) endosulfan (ISO) Enterolactone (ISO) ethanol (ISO) folic acid (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) geraniol (ISO) glycidyl methacrylate (ISO) gold atom (ISO) gold(0) (ISO) hexamethylcyclotrisiloxane (ISO) ibuprofen (ISO) imiquimod (ISO) indole-3-methanol (EXP,ISO) iron dichloride (ISO) L-methionine (ISO) Lasiocarpine (ISO) linsidomine (EXP) lipoic acid (ISO) lipopolysaccharide (ISO) lithocholic acid (ISO) lovastatin (ISO) lucanthone (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) monocrotaline (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (ISO) nitrogen mustard (ISO) O-methyleugenol (EXP) octamethylcyclotetrasiloxane (ISO) olaparib (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) phenethyl isothiocyanate (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) promethazine (EXP) quercetin (EXP,ISO) resveratrol (EXP,ISO) riddelliine (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) succimer (ISO) sunitinib (ISO) tamibarotene (ISO) temozolomide (ISO) testosterone (ISO) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) veliparib (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
brain development (IEA,ISO) cell population proliferation (IEA,ISO) cellular response to ionizing radiation (ISO) cellular senescence (IEA,ISO) centrosome duplication (ISO) chordate embryonic development (IEA,ISO) chromatin remodeling (IEA) chromosome organization (IEA,ISO) DNA damage response (IEA,ISO) DNA damage response, signal transduction by p53 class mediator (IEA,ISO) DNA recombination (IDA,IEA) DNA repair (IEA) double-strand break repair (IEA,ISO) double-strand break repair via homologous recombination (IBA,IEA,ISO,ISS) establishment of protein localization to telomere (IEA,ISO) female gonad development (IEA,ISO) hematopoietic stem cell proliferation (IEA,ISO) hemopoiesis (IEA,ISO) homologous chromosome orientation in meiotic metaphase I (IMP) inner cell mass cell proliferation (IEA,ISO) intrinsic apoptotic signaling pathway in response to DNA damage (IEA,ISO) intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator (IEA,ISO) male meiosis I (IEA,ISO) mammary gland development (IMP) mitotic recombination-dependent replication fork processing (ISO) multicellular organism growth (IMP) negative regulation of mammary gland epithelial cell proliferation (ISO) nucleotide-excision repair (ISO) oocyte maturation (IEA,ISO) positive regulation of DNA-templated transcription (ISO) positive regulation of mitotic cell cycle (IEA,ISO) regulation of cytokinesis (IEA,ISO) regulation of DNA-templated transcription (IBA) replication fork processing (IEA,ISO) response to estradiol (IEP) response to gamma radiation (IEA,ISO) response to nutrient (IEP) response to UV-C (IEA,ISO) response to X-ray (IEA,ISO) spermatogenesis (IEA,IMP,ISO) stem cell proliferation (IEA,ISO) telomere maintenance via recombination (IEA,ISO)
1.
Mutations in Fanconi anemia genes and the risk of esophageal cancer.
Akbari MR, etal., Hum Genet. 2011 May;129(5):573-82. doi: 10.1007/s00439-011-0951-7. Epub 2011 Jan 30.
2.
Localization of human BRCA1 and BRCA2 in non-inherited colorectal carcinomas and matched normal mucosas.
Bernard-Gallon DJ, etal., Anticancer Res. 2001 May-Jun;21(3B):2011-20.
3.
High incidence of BRCA1-2 germline mutations, previous breast cancer and familial cancer history in Jewish patients with uterine serous papillary carcinoma.
Biron-Shental T, etal., Eur J Surg Oncol. 2006 Dec;32(10):1097-100. Epub 2006 May 2.
4.
Effect of BRCA1/2 mutations on long-term survival of patients with invasive ovarian cancer: the national Israeli study of ovarian cancer.
Chetrit A, etal., J Clin Oncol. 2008 Jan 1;26(1):20-5.
5.
Characterizing a rat Brca2 knockout model.
Cotroneo MS, etal., Oncogene. 2006 Sep 11;.
6.
Characterizing a rat Brca2 knockout model.
Cotroneo MS, etal., Oncogene. 2007 Mar 8;26(11):1626-35. Epub 2006 Sep 11.
7.
Common variants of DNA repair genes and malignant melanoma.
Debniak T, etal., Eur J Cancer. 2008 Jan;44(1):110-4. Epub 2007 Nov 19.
8.
BRCA2 is required for neurogenesis and suppression of medulloblastoma.
Frappart PO, etal., EMBO J. 2007 Jun 6;26(11):2732-42. Epub 2007 May 3.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
A common missense variant in BRCA2 predisposes to early onset breast cancer.
Gorski B, etal., Breast Cancer Res. 2005;7(6):R1023-7. Epub 2005 Oct 24.
12.
Expression of DNA double-strand break repair proteins ATM and BRCA1 predicts survival in colorectal cancer.
Grabsch H, etal., Clin Cancer Res. 2006 Mar 1;12(5):1494-500. doi: 10.1158/1078-0432.CCR-05-2105.
13.
Regulation of homologous recombination in eukaryotes.
Heyer WD, etal., Annu Rev Genet. 2010;44:113-39. doi: 10.1146/annurev-genet-051710-150955.
14.
Biallelic inactivation of BRCA2 in Fanconi anemia.
Howlett NG, etal., Science 2002 Jul 26;297(5581):606-9. Epub 2002 Jun 13.
15.
Gene Data File
Integration of LocusLink data, October 12, 2001
16.
p53- and Bax-mediated apoptosis in injured rat spinal cord.
Kotipatruni RR, etal., Neurochem Res. 2011 Nov;36(11):2063-74. doi: 10.1007/s11064-011-0530-2. Epub 2011 Jul 7.
17.
A somatic BRCA2 mutation in RER+ endometrial carcinomas that specifically deletes the amino-terminal transactivation domain.
Koul A, etal., Genes Chromosomes Cancer. 1999 Mar;24(3):207-12.
18.
Evaluation of the protective effect of Nigella sativa extract and its primary active component thymoquinone against DMBA-induced breast cancer in female rats.
Linjawi SA, etal., Arch Med Sci. 2015 Mar 16;11(1):220-9. doi: 10.5114/aoms.2013.33329. Epub 2013 Feb 28.
19.
Loss of five amino acids in BRCA2 is associated with ovarian cancer.
Martinez SL, etal., J Med Genet. 2004 Feb;41(2):e18.
20.
Characterization of the rat and mouse homologues of the BRCA2 breast cancer susceptibility gene.
McAllister KA, etal., Cancer Res 1997 Aug 1;57(15):3121-5.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Prostate cancer in male BRCA1 and BRCA2 mutation carriers has a more aggressive phenotype.
Mitra A, etal., Br J Cancer. 2008 Jan 8;.
23.
Risk of cancer other than breast or ovarian in individuals with BRCA1 and BRCA2 mutations.
Moran A, etal., Fam Cancer. 2012 Jun;11(2):235-42. doi: 10.1007/s10689-011-9506-2.
24.
Hematopoietic dysfunction in a mouse model for Fanconi anemia group D1.
Navarro S, etal., Mol Ther. 2006 Oct;14(4):525-35. Epub 2006 Jul 20.
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
27.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
28.
Consortium analysis of 7 candidate SNPs for ovarian cancer.
Ramus SJ, etal., Int J Cancer. 2008 Jul 15;123(2):380-8. doi: 10.1002/ijc.23448.
29.
Biallelic BRCA2 mutations are associated with multiple malignancies in childhood including familial Wilms tumour.
Reid S, etal., J Med Genet. 2005 Feb;42(2):147-51.
30.
GOA pipeline
RGD automated data pipeline
31.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
32.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
33.
Comprehensive gene review and curation
RGD comprehensive gene curation
34.
Molecular characterization, homology modeling and docking studies of the R2787H missense variation in BRCA2 gene: Association with breast cancer.
Riahi A, etal., J Theor Biol. 2016 Aug 21;403:188-196. doi: 10.1016/j.jtbi.2016.05.013. Epub 2016 May 19.
35.
Breast cancer risk among male BRCA1 and BRCA2 mutation carriers.
Tai YC, etal., J Natl Cancer Inst. 2007 Dec 5;99(23):1811-4. Epub 2007 Nov 27.
36.
Phytoestrogen-rich diets modulate expression of Brca1 and Brca2 tumor suppressor genes in mammary glands of female Wistar rats.
Vissac-Sabatier C, etal., Cancer Res 2003 Oct 15;63(20):6607-12.
37.
Identification of the breast cancer susceptibility gene BRCA2.
Wooster R, etal., Nature. 1995 Dec 21-28;378(6559):789-92.
38.
Cloning of rat Brca2 and linkage mapping to chromosome 12.
Yamada S, etal., Mamm Genome 1997;8(11):850-1.
39.
BRCA2 function in DNA binding and recombination from a BRCA2-DSS1-ssDNA structure.
Yang H, etal., Science 2002 Sep 13;297(5588):1837-48.
40.
Genetic variants in fanconi anemia pathway genes BRCA2 and FANCA predict melanoma survival.
Yin J, etal., J Invest Dermatol. 2015 Feb;135(2):542-50. doi: 10.1038/jid.2014.416. Epub 2014 Sep 22.
41.
Enhanced induction of prostatic dysplasia and carcinoma in Noble rat model by combination of neonatal estrogen exposure and hormonal treatments at adulthood.
Yuen MT, etal., Int J Oncol. 2005 Dec;27(6):1685-95.
42.
Production of knockout rats using ENU mutagenesis and a yeast-based screening assay.
Zan Y, etal., Nat Biotechnol 2003 Jun;21(6):645-51.
Brca2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 4,895,092 - 4,939,340 (+) NCBI GRCr8 mRatBN7.2 12 59,492 - 103,789 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 59,819 - 100,567 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 628,555 - 669,267 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 1,150,791 - 1,191,504 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 50,374 - 91,100 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 503,660 - 544,754 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 504,007 - 544,748 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 490,733 - 535,090 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 4,282,952 - 4,323,693 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 4,282,951 - 4,323,693 NCBI Celera 12 1,769,467 - 1,810,212 (+) NCBI Celera Cytogenetic Map 12 p12 NCBI
BRCA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 32,315,077 - 32,400,268 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 32,315,086 - 32,400,268 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 32,889,214 - 32,974,405 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 31,787,617 - 31,871,809 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 31,787,616 - 31,871,805 NCBI Celera 13 13,956,447 - 14,040,613 (+) NCBI Celera Cytogenetic Map 13 q13.1 NCBI HuRef 13 13,701,252 - 13,785,592 (+) NCBI HuRef CHM1_1 13 32,857,164 - 32,941,322 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 31,532,322 - 31,617,510 (+) NCBI T2T-CHM13v2.0
Brca2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 150,445,759 - 150,493,612 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 150,446,095 - 150,493,794 (+) Ensembl GRCm39 Ensembl GRCm38 5 150,522,297 - 150,570,147 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 150,522,630 - 150,570,329 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 151,325,198 - 151,372,324 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 150,791,554 - 150,838,126 (+) NCBI MGSCv36 mm8 Celera 5 148,527,149 - 148,574,274 (+) NCBI Celera Cytogenetic Map 5 G3 NCBI cM Map 5 89.52 NCBI
Brca2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 13,449,543 - 13,527,432 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 13,449,287 - 13,526,878 (-) NCBI ChiLan1.0 ChiLan1.0
BRCA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 31,881,434 - 31,965,986 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 22,987,931 - 23,072,490 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 13,574,422 - 13,658,967 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 32,009,039 - 32,092,463 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 32,010,066 - 32,091,332 (+) Ensembl panpan1.1 panPan2
BRCA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 7,734,450 - 7,797,851 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 7,734,453 - 7,797,815 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 7,764,412 - 7,827,765 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 7,830,897 - 7,895,637 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 7,831,514 - 7,895,646 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 7,730,810 - 7,794,166 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 7,729,079 - 7,792,446 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 7,786,384 - 7,849,984 (-) NCBI UU_Cfam_GSD_1.0
Brca2
BRCA2
BRCA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 11,070,086 - 11,155,257 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 11,071,682 - 11,155,213 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 33,194,816 - 33,282,150 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Brca2
.
Predicted Target Of
Count of predictions: 13 Count of miRNA genes: 13 Interacting mature miRNAs: 13 Transcripts: ENSRNOT00000001475 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 9318387 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat
D12Rat58
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 91,605 - 91,764 (+) MAPPER mRatBN7.2 Rnor_6.0 12 535,793 - 535,951 NCBI Rnor6.0 Rnor_5.0 12 522,811 - 522,969 UniSTS Rnor5.0 RGSC_v3.4 12 4,291,748 - 4,291,907 RGD RGSC3.4 RGSC_v3.4 12 4,291,749 - 4,291,907 UniSTS RGSC3.4 RGSC_v3.1 12 4,291,748 - 4,291,907 RGD Celera 12 1,801,251 - 1,801,409 UniSTS SHRSP x BN Map 12 2.13 RGD SHRSP x BN Map 12 2.13 UniSTS Cytogenetic Map 12 p12 UniSTS
This gene Brca2 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001475 ⟹ ENSRNOP00000001475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 59,819 - 100,567 (+) Ensembl Rnor_6.0 Ensembl 12 504,007 - 544,748 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103794 ⟹ ENSRNOP00000096899
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 59,819 - 100,567 (+) Ensembl
RefSeq Acc Id:
NM_031542 ⟹ NP_113730
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,447 - 4,936,194 (+) NCBI mRatBN7.2 12 59,819 - 100,567 (+) NCBI Rnor_6.0 12 504,007 - 544,754 (+) NCBI Rnor_5.0 12 490,733 - 535,090 (+) NCBI RGSC_v3.4 12 4,282,952 - 4,323,693 (-) RGD Celera 12 1,769,467 - 1,810,212 (+) NCBI
Sequence:
CCGTAATTAGTTAACGTGAATACTTTTAAATGACGTTAAGTTTTTCTGGTTATTGGCTCCCACCATATCCGCTTTCGGGTGCAGTTTGGTTCGAAGCACAATTATAATCTCTCCCCATCTTCATGATA
hide sequence
RefSeq Acc Id:
XM_017598372 ⟹ XP_017453861
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,936,194 (+) NCBI mRatBN7.2 12 59,492 - 100,575 (+) NCBI Rnor_6.0 12 503,660 - 544,754 (+) NCBI
Sequence:
CACGGCGCAGAGCGCGGGCTTTTCGCAGGAGCGTGAGAAGTGAGGCGGCGCCGTCCGTCAGCGGCCGCAACCCGAGCGTGTCAGTGGGGCCGGGTGTTGTGGGGCCGGGTGTTGTGGGCACGCGCTCC
hide sequence
RefSeq Acc Id:
XM_039089540 ⟹ XP_038945468
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,936,194 (+) NCBI mRatBN7.2 12 59,492 - 100,575 (+) NCBI
RefSeq Acc Id:
XM_039089541 ⟹ XP_038945469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,936,002 (+) NCBI mRatBN7.2 12 59,492 - 100,375 (+) NCBI
RefSeq Acc Id:
XM_039089542 ⟹ XP_038945470
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,936,194 (+) NCBI mRatBN7.2 12 59,492 - 100,575 (+) NCBI
RefSeq Acc Id:
XM_039089543 ⟹ XP_038945471
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,936,194 (+) NCBI mRatBN7.2 12 59,492 - 100,375 (+) NCBI
RefSeq Acc Id:
XM_039089544 ⟹ XP_038945472
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,918,922 (+) NCBI mRatBN7.2 12 59,492 - 83,297 (+) NCBI
RefSeq Acc Id:
XR_005491644
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 4,895,092 - 4,939,340 (+) NCBI mRatBN7.2 12 59,492 - 103,789 (+) NCBI
RefSeq Acc Id:
NP_113730 ⟸ NM_031542
- UniProtKB:
O35923 (UniProtKB/Swiss-Prot), Q66MH4 (UniProtKB/TrEMBL)
- Sequence:
MTVEYKRRPTFWEIFKARCSTADLGPISLNWFEELSSEAPPYNTEPPEESEYKPQGHEPQLFKTPQRNPSYHQFASTPIMFKEQSQTLPLDQSPFKELGNVVANSKRKHHSKKKARKDPVVDVASLPL
hide sequence
RefSeq Acc Id:
XP_017453861 ⟸ XM_017598372
- Peptide Label:
isoform X2
- UniProtKB:
O35923 (UniProtKB/Swiss-Prot), Q66MH4 (UniProtKB/TrEMBL)
- Sequence:
MTVEYKRRPTFWEIFKARCSTADLGPISLNWFEELSSEAPPYNTEPPEESEYKPQGHEPQLFKT
hide sequence
Ensembl Acc Id:
ENSRNOP00000001475 ⟸ ENSRNOT00000001475
RefSeq Acc Id:
XP_038945468 ⟸ XM_039089540
- Peptide Label:
isoform X1
- UniProtKB:
O35923 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945470 ⟸ XM_039089542
- Peptide Label:
isoform X4
- UniProtKB:
O35923 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945469 ⟸ XM_039089541
- Peptide Label:
isoform X3
- UniProtKB:
O35923 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945471 ⟸ XM_039089543
- Peptide Label:
isoform X5
- UniProtKB:
O35923 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945472 ⟸ XM_039089544
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000096899 ⟸ ENSRNOT00000103794
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-01
Brca2
BRCA2, DNA repair associated
Brca2
breast cancer 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-25
Brca2
breast cancer 2
Brca2
breast cancer 2, early onset
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-01-14
Brca2
breast cancer 2, early onset
Brca2
breast cancer 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Brca2
breast cancer 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains three oligonucleotide-binding (OB) folds, a helix-turn-helix (HTH) motif and a BRCA2 domain
632363
gene_expression
mRNA expression highest in testis, low in liver and lung, minimal in kidneys and brain
70324
