Advanced Search (OLGA)

Gene: Kcnc4 (potassium voltage-gated channel subfamily C member 4) Rattus norvegicus

Analyze

Symbol:

Kcnc4

Name:

potassium voltage-gated channel subfamily C member 4

RGD ID:

1589169

Description:

Enables voltage-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential; voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential; and voltage-gated potassium channel activity. Involved in negative regulation of neuronal action potential and nervous system development. Located in several cellular components, including cell surface; neuronal cell body; and synaptic vesicle. Is active in several cellular components, including calyx of Held; glycinergic synapse; and synaptic membrane. Biomarker of sciatic neuropathy and status epilepticus. Orthologous to human KCNC4 (potassium voltage-gated channel subfamily C member 4); INTERACTS WITH (+)-pilocarpine; (5Z,8Z,11Z,13E)-15-HETE; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC684516; potassium channel, voltage gated Shaw-related subfamily C, member 4; potassium voltage gated channel, Shaw-related subfamily, member 4; potassium voltage-gated channel subfamily C member 4 (Voltage-gated potassium channel subunit Kv3.4) (Raw3); raw3; similar to Potassium voltage-gated channel subfamily C member 4 (Voltage-gated potassium channel subunit Kv3.4) (Raw3); voltage-gated potassium channel KCNC4; voltage-gated potassium channel subunit Kv3.4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	197,747,095 - 197,788,467 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	197,759,010 - 197,788,433 (-)	Ensembl				GRCr8
mRatBN7.2	2	195,063,967 - 195,100,244 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	195,071,769 - 195,099,233 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	202,720,130 - 202,740,385 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	200,602,290 - 200,622,540 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	195,419,233 - 195,439,487 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	210,220,908 - 210,241,447 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	210,220,908 - 210,241,455 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	229,694,932 - 229,732,890 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	2	187,727,839 - 187,748,108 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

Hyperalgesia (IMP)

sciatic neuropathy (IEP)

status epilepticus (IEP)

temporal lobe epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

(5Z,8Z,11Z,13E)-15-HETE (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bucladesine (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clothianidin (ISO)

Dibutyl phosphate (ISO)

dichloroacetic acid (ISO)

dimethylselenide (ISO)

dioxygen (ISO)

entinostat (ISO)

ethanol (EXP,ISO)

fulvestrant (ISO)

genistein (ISO)

kainic acid (EXP)

lead(0) (ISO)

medroxyprogesterone acetate (ISO)

okadaic acid (ISO)

ozone (ISO)

perfluorooctanoic acid (EXP)

pioglitazone (ISO)

rac-lactic acid (ISO)

reactive oxygen species (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

action potential (IBA)

axon development (IEP)

cerebral cortex development (IEP)

corpus callosum development (IEP)

forebrain development (IEA,IEP)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

negative regulation of neuronal action potential (IMP)

optic nerve development (IEA,IEP)

potassium ion transmembrane transport (IBA,IEA)

potassium ion transport (IEA)

protein homooligomerization (IEA)

regulation of neurotransmitter secretion (ISO)

regulation of postsynaptic membrane potential (IEA)

regulation of presynaptic membrane potential (IEA)

transmembrane transport (IEA)

Cellular Component

axon (IDA)

axon terminus (IBA,IEA,ISO)

calyx of Held (IDA)

cell surface (IDA)

dendrite (IDA)

dendrite membrane (IBA)

glutamatergic synapse (IDA)

glycinergic synapse (IDA)

membrane (IEA)

monoatomic ion channel complex (IEA)

neuromuscular junction (ISO)

neuron projection (IEA)

neuronal cell body (IDA)

neuronal cell body membrane (IBA)

postsynapse (IDA)

postsynaptic membrane (IBA,IDA)

presynaptic membrane (IBA,IDA,IEA)

synaptic vesicle (IDA)

voltage-gated potassium channel complex (IBA,IEA)

Molecular Function

delayed rectifier potassium channel activity (IBA)

metal ion binding (IEA)

monoatomic ion channel activity (IEA)

potassium channel activity (IEA)

protein binding (IPI,ISO)

voltage-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential (IDA,IMP,NAS)

voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential (IDA,IMP,NAS)

voltage-gated potassium channel activity (IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Up-regulation of the Kv3.4 potassium channel subunit in early stages of Alzheimer's disease.	Angulo E, etal., J Neurochem. 2004 Nov;91(3):547-57.
2.	Kv3.4 subunits enhance the repolarizing efficiency of Kv3.1 channels in fast-spiking neurons.	Baranauskas G, etal., Nat Neurosci. 2003 Mar;6(3):258-66. doi: 10.1038/nn1019.
3.	Brain expression of Kv3 subunits during development, adulthood and aging and in a murine model of Alzheimer's disease.	Boda E, etal., J Mol Neurosci. 2012 Mar;46(3):606-15. doi: 10.1007/s12031-011-9648-6. Epub 2011 Sep 13.
4.	Association of potassium channel Kv3.4 subunits with pre- and post-synaptic structures in brainstem and spinal cord.	Brooke RE, etal., Neuroscience. 2004;126(4):1001-10.
5.	Reduced expression of A-type potassium channels in primary sensory neurons induces mechanical hypersensitivity.	Chien LY, etal., J Neurosci. 2007 Sep 12;27(37):9855-65.
6.	Voltage-gated potassium currents within the dorsal vagal nucleus: inhibition by BDS toxin.	Dallas ML, etal., Brain Res. 2008 Jan 16;1189:51-7. Epub 2007 Nov 9.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Coexpression of high-voltage-activated ion channels Kv3.4 and Cav1.2 in pioneer axons during pathfinding in the developing rat forebrain.	Huang CY, etal., J Comp Neurol. 2012 Nov 1;520(16):3650-72. doi: 10.1002/cne.23119.
9.	Distinct roles of Kv1 and Kv3 potassium channels at the calyx of Held presynaptic terminal.	Ishikawa T, etal., J Neurosci. 2003 Nov 12;23(32):10445-53.
10.	KCNE1 and KCNE2 inhibit forward trafficking of homomeric N-type voltage-gated potassium channels.	Kanda VA, etal., Biophys J. 2011 Sep 21;101(6):1354-63. doi: 10.1016/j.bpj.2011.08.015. Epub 2011 Sep 20.
11.	KCNE1 and KCNE2 provide a checkpoint governing voltage-gated potassium channel a-subunit composition.	Kanda VA, etal., Biophys J. 2011 Sep 21;101(6):1364-75. doi: 10.1016/j.bpj.2011.08.014. Epub 2011 Sep 20.
12.	[Kv3.4 channel is involved in rat pulmonary vasoconstriction induced by 15-hydroxyeicosatetraenoic acid].	Li Q, etal., Sheng Li Xue Bao. 2006 Feb 25;58(1):77-82.
13.	Chronic deficit in the expression of voltage-gated potassium channel Kv3.4 subunit in the hippocampus of pilocarpine-treated epileptic rats.	Pacheco Otalora LF, etal., Brain Res. 2011 Jan 12;1368:308-16. doi: 10.1016/j.brainres.2010.10.047. Epub 2010 Oct 21.
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Comprehensive gene review and curation	RGD comprehensive gene curation
18.	Cloning and functional expression of a TEA-sensitive A-type potassium channel from rat brain.	Schröter KH, etal., FEBS Lett. 1991 Jan 28;278(2):211-6. doi: 10.1016/0014-5793(91)80119-n.
19.	Identification of a Kv3.4 channel in corneal epithelial cells.	Wang L, etal., Invest Ophthalmol Vis Sci. 2004 Jun;45(6):1796-803.
20.	Reduced ictogenic potential of 4-aminopyridine in the perirhinal and entorhinal cortex of kainate-treated chronic epileptic rats.	Zahn RK, etal., Neurobiol Dis. 2008 Feb;29(2):186-200. Epub 2007 Sep 4.

Additional References at PubMed

PMID:1378392	PMID:9000078	PMID:10048926	PMID:15610163	PMID:17495071	PMID:18430420	PMID:26039360	PMID:33368632

Genomics

Comparative Map Data

Kcnc4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	197,747,095 - 197,788,467 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	197,759,010 - 197,788,433 (-)	Ensembl				GRCr8
mRatBN7.2	2	195,063,967 - 195,100,244 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	195,071,769 - 195,099,233 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	202,720,130 - 202,740,385 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	200,602,290 - 200,622,540 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	195,419,233 - 195,439,487 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	210,220,908 - 210,241,447 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	210,220,908 - 210,241,455 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	229,694,932 - 229,732,890 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	2	187,727,839 - 187,748,108 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

KCNC4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	110,210,314 - 110,284,080 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	110,210,314 - 110,283,100 (+)	Ensembl			hg38	GRCh38
GRCh37	1	110,752,936 - 110,776,666 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	110,555,588 - 110,578,189 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	110,466,018 - 110,478,710	NCBI
Celera	1	109,000,516 - 109,023,855 (+)	NCBI		Celera
Cytogenetic Map	1	p13.3	NCBI
HuRef	1	108,625,031 - 108,648,390 (+)	NCBI		HuRef
CHM1_1	1	110,868,669 - 110,892,012 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	110,225,284 - 110,300,705 (+)	NCBI		T2T-CHM13v2.0

Kcnc4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	107,345,614 - 107,367,617 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	107,345,619 - 107,366,868 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	107,438,298 - 107,460,287 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	107,438,303 - 107,459,552 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	107,241,221 - 107,261,816 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	107,566,359 - 107,586,954 (-)	NCBI		MGSCv36	mm8
Celera	3	109,770,042 - 109,791,022 (-)	NCBI		Celera
Cytogenetic Map	3	F2.3	NCBI
cM Map	3	46.83	NCBI

Kcnc4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	13,728,708 - 13,750,660 (+)	Ensembl
ChiLan1.0	NW_004955435	13,728,272 - 13,750,420 (+)	NCBI	ChiLan1.0	ChiLan1.0

KCNC4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	116,703,093 - 116,828,565 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	115,952,375 - 115,976,166 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	112,860,887 - 112,884,687 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	127,457,895 - 127,480,954 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	127,458,968 - 127,480,182 (-)	Ensembl			panPan2	panpan1.1

KCNC4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	41,743,214 - 41,764,572 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	41,738,653 - 41,764,578 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	44,496,309 - 44,541,283 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	42,051,239 - 42,096,226 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	42,075,855 - 42,096,111 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	6	41,742,375 - 41,787,313 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	42,177,396 - 42,222,420 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Kcnc4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	18,424,809 - 18,446,759 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936704	1,667,387 - 1,689,348 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936704	1,667,387 - 1,689,337 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KCNC4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	109,885,116 - 109,908,476 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	109,885,116 - 109,908,518 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	120,280,838 - 120,310,013 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KCNC4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	23,241,279 - 23,328,175 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	23,304,679 - 23,327,382 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	35,131,024 - 35,168,004 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kcnc4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	5,967,071 - 5,991,484 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624772	5,967,042 - 6,004,647 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Kcnc4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	50,796,416 - 50,824,082 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Kcnc4
192 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	112
Count of miRNA genes:	78
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000072174
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	199723085	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	199723085	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	199723085	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	199723085	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	199723085	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Markers in Region

D2Rat259

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	197,796,761 - 197,796,980 (+)	Marker Load Pipeline
mRatBN7.2	2	195,108,573 - 195,108,792 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,250,800 - 210,251,018	NCBI	Rnor6.0
Rnor_5.0	2	229,724,205 - 229,724,423	UniSTS	Rnor5.0
Celera	2	187,757,448 - 187,757,666	UniSTS
FHH x ACI Map	2	88.8099	RGD
FHH x ACI Map	2	88.8099	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH135159

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,108,542 - 195,108,739 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,250,769 - 210,250,965	NCBI	Rnor6.0
Rnor_5.0	2	229,724,174 - 229,724,370	UniSTS	Rnor5.0
Celera	2	187,757,417 - 187,757,613	UniSTS
RH 3.4 Map	2	1388.3	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH143000

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,096,317 - 195,096,502 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,238,545 - 210,238,729	NCBI	Rnor6.0
Rnor_5.0	2	229,712,569 - 229,712,753	UniSTS	Rnor5.0
Celera	2	187,745,185 - 187,745,369	UniSTS
RH 3.4 Map	2	1377.3	UniSTS
Cytogenetic Map	2	q34	UniSTS

BE108672

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,104,398 - 195,104,575 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,246,625 - 210,246,801	NCBI	Rnor6.0
Rnor_5.0	2	229,720,030 - 229,720,206	UniSTS	Rnor5.0
Celera	2	187,753,273 - 187,753,449	UniSTS
RH 3.4 Map	2	1377.3	UniSTS
Cytogenetic Map	2	q34	UniSTS

BE108676

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,102,583 - 195,102,735 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,244,810 - 210,244,961	NCBI	Rnor6.0
Rnor_5.0	2	229,718,215 - 229,718,366	UniSTS	Rnor5.0
Celera	2	187,751,458 - 187,751,609	UniSTS
RH 3.4 Map	2	1376.9	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH136805

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,109,249 - 195,109,390 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,251,476 - 210,251,616	NCBI	Rnor6.0
Rnor_5.0	2	229,724,881 - 229,725,021	UniSTS	Rnor5.0
Celera	2	187,758,124 - 187,758,264	UniSTS
RH 3.4 Map	2	1388.3	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH137842

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,110,538 - 195,110,694 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,252,765 - 210,252,920	NCBI	Rnor6.0
Rnor_5.0	2	229,726,170 - 229,726,325	UniSTS	Rnor5.0
Celera	2	187,759,413 - 187,759,568	UniSTS
RH 3.4 Map	2	1378.5	UniSTS
Cytogenetic Map	2	q34	UniSTS

KCNC4_1814

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	195,087,602 - 195,088,387 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	210,229,830 - 210,230,614	NCBI	Rnor6.0
Rnor_5.0	2	229,703,854 - 229,704,638	UniSTS	Rnor5.0
Celera	2	187,736,470 - 187,737,254	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	12	65	152	50	47	19	86	19	6	305	184	11	124	81	85	28	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001122776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X62841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086420 ⟹ ENSRNOP00000068863

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	197,759,010 - 197,788,433 (-)	Ensembl
mRatBN7.2 Ensembl	2	195,071,769 - 195,099,233 (-)	Ensembl
Rnor_6.0 Ensembl	2	210,220,908 - 210,241,455 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093977 ⟹ ENSRNOP00000087803

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	197,766,650 - 197,788,433 (-)	Ensembl
mRatBN7.2 Ensembl	2	195,075,994 - 195,099,233 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162236 ⟹ ENSRNOP00000100695

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	197,770,623 - 197,788,433 (-)	Ensembl

RefSeq Acc Id:

NM_001122776 ⟹ NP_001116248

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,766,650 - 197,788,433 (-)	NCBI
mRatBN7.2	2	195,078,461 - 195,100,244 (-)	NCBI
Rnor_6.0	2	210,220,908 - 210,241,447 (-)	NCBI
Rnor_5.0	2	229,694,932 - 229,732,890 (-)	NCBI
Celera	2	187,727,839 - 187,748,108 (-)	RGD

Sequence:

show sequence

GTGCGCTTCTCTGTCTTTCTGGGGTTGGGGGGGGCGTGTCCCCGGCCCGGAGCATCCTTGTGCT
TGCCTCAACCTTCTGAGACCCCGGACCCCTTGGATTGAGTCCTCGACCCTGGTCTTCACCTCCT
GCCTCCCCTAGGTTCTTCCTGCCAAATCCCAACCACCTGTGCACCACAAAAAGCCAACTCTTCC
TGCTCCGAGCCCCGGGGGGGTGGGGTGGGGGGGAGGCAGGGGCAGAGCCACTCTGCAGAAGGGG
CCGCCACCACCTCCTGCCTCCTCCTCCTCCACCACCTCCTCCTCCTTCTCGTCTCCTCCCCCTC
CCCGTTCTGACGCTGCCTCCTTGGGAAGGGTGTTTGGAGGGCAGCGGCCGCCCCAAGCCGGAGC
CCCGCAGCGCTTCTTATGATCAGCTCGGTGTGTGTCTCCTCCTACCGCGGGCGCAAGTCGGGGA
ACAAGCCTCCGTCCAAAACATGTCTGAAGGAGGAGATGGCCAAGGGCGAGGCGTCGGAGAAGAT
CATCATCAACGTGGGCGGCACGCGACATGAGACCTACCGCAGCACCCTGCGCACCCTACCGGGC
ACCCGCCTTGCCTGGCTGGCGGATCCCGACGGCGGGGGTCGGCCAGAGTCGGATGGCGGCGGTG
CAGGCAGCAGCGGCAGCAGCGGCGGCGGCGGGGGCTGTGAGTTCTTCTTTGATCGGCACCCGGG
TGTTTTTGCCTATGTGCTCAACTACTACCGCACGGGCAAGCTGCATTGCCCCGCAGACGTCTGT
GGGCCTCTCTTTGAGGAAGAGCTCACTTTCTGGGGTATCGATGAGACAGATGTGGAACCCTGCT
GCTGGATGACCTACCGGCAGCACCGCGATGCTGAAGAGGCACTGGACATCTTCGAGAGCCCGGA
CGGGGGCGGGGGTGGCGCAGGGCCCGGCGACGAGGCTGGAGACGATGAGCGGGAGTTGGCCTTG
CAGCGCCTGGGCCCCCATGAAGGAGGCTCTGGCCCTGGTGCTGGGTCCGGGGGTTGCCGTGGCT
GGCAGCCCCGAATGTGGGCGCTCTTCGAGGACCCGTACTCATCCCGGGCGGCCAGGGTGGTAGC
CTTTGCCTCTCTCTTCTTCATCTTGGTCTCCATTACCACCTTCTGCCTGGAGACCCACGAGGCC
TTCAACATTGACCGAAATGTGACGGAGATCCACCGGGTAGGGAATATCACCAGCGTGCGCTTCC
GGCGGGAGGTAGAAACAGAACCCATTCTTACCTACATCGAGGGCGTGTGCGTGATGTGGTTCAC
TCTAGAGTTCCTGGTTCGCATTGTGTGCTGCCCTGATACGTTGGACTTTGTCAAGAACCTGCTC
AACATCATCGACTTTGTGGCCATCTTGCCCTTTTACCTGGAGGTGGGATTGAGTGGCCTGTCAT
CCAAGGCAGCTCGAGATGTGCTGGGTTTCCTGCGTGTGGTGCGCTTTGTACGCATCCTGCGGAT
CTTCAAGCTCACACGCCACTTTGTGGGGCTGCGTGTGCTCGGCCACACACTCCGGGCCAGCACC
AACGAGTTCCTGCTGCTTATCATCTTCCTGGCCCTGGGTGTGCTCATCTTTGCCACCATGATCT
ATTATGCTGAGCGAATCGGGGCCAGGCCATCTGACCCACGGGGCAATGACCACACCGACTTCAA
GAACATCCCCATCGGTTTCTGGTGGGCTGTGGTCACCATGACAACGCTTGGCTATGGGGACATG
TATCCTAAGACATGGTCAGGAATGCTGGTGGGTGCGCTGTGTGCACTGGCTGGTGTGCTAACCA
TTGCCATGCCTGTGCCTGTCATCGTCAATAACTTTGGTATGTACTACTCCCTGGCTATGGCCAA
GCAGAAGCTTCCCAAGAAACGAAAGAAGCATGTACCACGGCCACCCCAGCTTGAGTCACCCATT
TACTGCAAGTCTGAGGAGACTTCACCCCGGGACAGCACCTACAGTGACACCAGCCCCCCTGCCC
GGGAAGAGGGTATGGTCGAGAGGAAACGAGCAGACTCCAAGCAGAATGGTGACGCTAATGCGGT
GCTGTCCGATGAGGAGGGAGCTGGCCTCACCCAGCCCCTGGCCTCGGCCCCCACCCCTGAAGAG
CGTCGAGCCCTGAGACGCTCAGGCACACGGGACAGAAACAAGAAGGCAGCTGCCTGCTTCCTGC
TCAGTGCTGGGGACTATGCCTGTGCTGATGGCAGTGTCCAGAAAGAAGGCAGTGTTGAGCCGAA
AGCGTGCGTCCCAGTGTCTCACACCTGTGCTCTTTAAACACAGAGACCTGCCAAGACGCCCTCT
CGTCCAACTATGCCCATGCTGAAGTCCTCACCCTCTCTTAGAGCGGCACCAACGTGAGAAAGAC
AGACAGACAGAAAGCCAGAGGCTTAGGAAAACTCTGGAACCCAGGCACGAATCTTTTGCTGGGA
AAGATATCCTTGTTTGCACAAGACTGGTGGAAAAATCTCCCATGCAACTCTCAGGGCCCAGAGC
CATCTGGGTCTGATACTCTGTTCTACTGTACATTGAAGAGACATATATGCACATATAGTATCTA
TATTCATACATACTATATACTCTTGTGTGTAGTGCACGTGCTACTGGTGGTCTGTCTTCATCGT
TAGGCTATGTCTCCCAAGTCCTCTGCCCACCCTGTTTCCCCACCCCCTCTTCCTTCATGGATTG
TTTCTTCTGACCATGTTTTTGGAGTGTCCCAGGAGAGGTATACCTGGGACCTGCCCCTCCAGCT
GGGTGGTCCCAGGCTGCTCTCACTTGGGGGTGTCCCCTGCCAGCAGGTGGCCTGCTGAAGTCAG
TTGAAGGCACGATTGCCCTTCTGGGGTCACTGCTTCACTAGC

hide sequence

RefSeq Acc Id:

NM_001415110 ⟹ NP_001402039

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,766,650 - 197,788,433 (-)	NCBI
mRatBN7.2	2	195,078,461 - 195,100,244 (-)	NCBI

RefSeq Acc Id:

XM_039103129 ⟹ XP_038959057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,766,650 - 197,788,467 (-)	NCBI
mRatBN7.2	2	195,079,615 - 195,098,870 (-)	NCBI

RefSeq Acc Id:

XM_039103131 ⟹ XP_038959059

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,747,095 - 197,787,221 (-)	NCBI
mRatBN7.2	2	195,063,967 - 195,098,870 (-)	NCBI

RefSeq Acc Id:

XR_010063660

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,747,095 - 197,787,221 (-)	NCBI

RefSeq Acc Id:

XR_010063661

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,747,095 - 197,787,221 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001116248	(Get FASTA)	NCBI Sequence Viewer
	NP_001402039	(Get FASTA)	NCBI Sequence Viewer
	XP_038959057	(Get FASTA)	NCBI Sequence Viewer
	XP_038959059	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA44645	(Get FASTA)	NCBI Sequence Viewer
	EDL81877	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000068863
	ENSRNOP00000087803
	ENSRNOP00000100695
GenBank Protein	Q63734	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001116248 ⟸ NM_001122776
- Peptide Label:	isoform 2
- UniProtKB:	Q63734 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAW LADPDGGGRPESDGGGAGSSGSSGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFE EELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGDDERELALQRLGP HEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDR NVTEIHRVGNITSVRFRREVETEPILTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDF VAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLL LIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTW SGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPPQLESPIYCKSE ETSPRDSTYSDTSPPAREEGMVERKRADSKQNGDANAVLSDEEGAGLTQPLASAPTPEERRALR RSGTRDRNKKAAACFLLSAGDYACADGSVQKEGSVEPKACVPVSHTCAL hide sequence

Ensembl Acc Id:

ENSRNOP00000068863 ⟸ ENSRNOT00000086420

RefSeq Acc Id:	XP_038959059 ⟸ XM_039103131
- Peptide Label:	isoform X2
- UniProtKB:	Q63734 (UniProtKB/Swiss-Prot), A0A0G2JTV8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038959057 ⟸ XM_039103129
- Peptide Label:	isoform X1
- UniProtKB:	Q63734 (UniProtKB/Swiss-Prot), A0A8I6GGE0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000087803 ⟸ ENSRNOT00000093977

RefSeq Acc Id:	NP_001402039 ⟸ NM_001415110
- Peptide Label:	isoform 1
- UniProtKB:	Q63734 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000100695 ⟸ ENSRNOT00000162236

Protein Domains

BTB

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63734-F1-model_v2	AlphaFold	Q63734	1-625	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1589169	AgrOrtholog
BioCyc Gene	G2FUF-51672	BioCyc
Ensembl Genes	ENSRNOG00000060988	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000086420	ENTREZGENE
	ENSRNOT00000093977	ENTREZGENE
	ENSRNOT00000162236	ENTREZGENE
Gene3D-CATH	1.10.287.70	UniProtKB/Swiss-Prot
	1.20.120.350	UniProtKB/Swiss-Prot
	Potassium Channel Kv1.1, Chain A	UniProtKB/Swiss-Prot
InterPro	BTB/POZ_dom	UniProtKB/Swiss-Prot
	Ion_trans_dom	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_Kv	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_Kv3	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_Kv3.4	UniProtKB/Swiss-Prot
	Shal-type_N	UniProtKB/Swiss-Prot
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot
	T1-type_BTB	UniProtKB/Swiss-Prot
	VG_K_chnl	UniProtKB/Swiss-Prot
	Volt_channel_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:684516	UniProtKB/Swiss-Prot
NCBI Gene	684516	ENTREZGENE
PANTHER	POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY C MEMBER 4	UniProtKB/Swiss-Prot
	PTHR11537	UniProtKB/Swiss-Prot
Pfam	BTB_2	UniProtKB/Swiss-Prot
	Ion_trans	UniProtKB/Swiss-Prot
	Shal-type	UniProtKB/Swiss-Prot
PhenoGen	Kcnc4	PhenoGen
PRINTS	KCHANNEL	UniProtKB/Swiss-Prot
	KV34CHANNEL	UniProtKB/Swiss-Prot
	KVCHANNEL	UniProtKB/Swiss-Prot
	SHAWCHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000060988	RatGTEx
SMART	BTB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54695	UniProtKB/Swiss-Prot
	Voltage-gated potassium channels	UniProtKB/Swiss-Prot
UniProt	A0A0G2JTV8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GGE0	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LD18_RAT	UniProtKB/TrEMBL
	KCNC4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Kcnc4	potassium voltage-gated channel subfamily C member 4	Kcnc4	potassium channel, voltage gated Shaw-related subfamily C, member 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-01-26	Kcnc4	potassium channel, voltage gated Shaw-related subfamily C, member 4	Kcnc4	potassium voltage gated channel, Shaw-related subfamily, member 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-23	Kcnc4	potassium voltage gated channel, Shaw-related subfamily, member 4	LOC684516	similar to Potassium voltage-gated channel subfamily C member 4 (Voltage-gated potassium channel subunit Kv3.4) (Raw3)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC684516	similar to Potassium voltage-gated channel subfamily C member 4 (Voltage-gated potassium channel subunit Kv3.4) (Raw3)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD