Acp3 (acid phosphatase 3) - Rat Genome Database

Name: Acp3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Acp3 (acid phosphatase 3) Rattus norvegicus

Analyze

Symbol:

Acp3

Name:

acid phosphatase 3

RGD ID:

2023

Description:

Enables acid phosphatase activity; choline binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including nucleobase-containing small molecule metabolic process; positive regulation of adenosine receptor signaling pathway; and thiamine metabolic process. Located in Golgi cisterna; apical part of cell; and cytoplasmic vesicle. Human ortholog(s) of this gene implicated in prostate cancer. Orthologous to human ACP3 (acid phosphatase 3); PARTICIPATES IN riboflavin metabolic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

5'-NT; 5'-nucleotidase; acid phosphatase prostate; acid phosphatase, prostate; Acpp; Acpp11; ecto-5'-nucleotidase; fluoride-resistant acid phosphatase; FRAP; pap; Ppal; prostatic acid phosphatase; prostatic acid phosphatase (rPAP); RNACPP11; thiamine monophosphatase; TMPase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACP3 (acid phosphatase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Acp3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Acp3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACP3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACP3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acp3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACP3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACP3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acp3 (acid phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ACP3 (acid phosphatase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Acp3 (acid phosphatase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Acph-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6656	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|PANTHER)
Drosophila melanogaster (fruit fly):	CG9449	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG9451	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|PANTHER)
Drosophila melanogaster (fruit fly):	CG9452	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	pho-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pho-8	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	pho-6	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Coreg1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	113,784,372 - 113,833,033 (-)	NCBI		GRCr8
mRatBN7.2	8	104,905,570 - 104,956,146 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	104,905,586 - 104,954,236 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	110,555,965 - 110,601,143 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	108,755,152 - 108,800,326 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	106,597,855 - 106,643,027 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	112,838,574 - 112,884,062 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	112,834,707 - 112,884,077 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	112,224,707 - 112,272,400 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	109,354,381 - 109,400,296 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	109,382,705 - 109,419,751 (-)	NCBI
Celera	8	104,274,154 - 104,317,190 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alkaptonuria (ISO)

juvenile rheumatoid arthritis (ISO)

Primary Lymphedema with Myelodysplasia (ISO)

prostate cancer (ISO,ISS)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

8-Br-cAMP (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bicalutamide (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

carmustine (EXP)

clofibric acid (EXP)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diclofenac (ISO)

diquat (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ellagic acid (ISO)

endosulfan (EXP)

ethylparaben (ISO)

finasteride (EXP)

gemcitabine (ISO)

genistein (ISO)

gentamycin (EXP)

indole-3-methanol (EXP)

lipopolysaccharide (ISO)

medroxyprogesterone acetate (ISO)

mercury dibromide (ISO)

methotrexate (EXP)

methoxychlor (EXP)

methylseleninic acid (ISO)

Muraglitazar (EXP)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (EXP)

progesterone (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

Swertiamarin (EXP)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

thioacetamide (EXP)

tioguanine (EXP)

triadimefon (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

undecane (EXP)

valproic acid (ISO)

vanadyl sulfate (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenosine metabolic process (IEA,ISO)

dephosphorylation (IDA)

lipid metabolic process (IEA)

lysosome organization (IBA)

nucleotide metabolic process (IEA,ISO)

positive regulation of adenosine receptor signaling pathway (IEA,ISO)

purine nucleobase metabolic process (IEA,ISO)

regulation of sensory perception of pain (IEA,ISO)

thiamine metabolic process (IEA,ISO)

Cellular Component

apical part of cell (IDA)

extracellular space (IEA,ISO)

filopodium (IEA,ISO)

Golgi cisterna (IDA)

lysosomal membrane (IEA)

lysosome (IBA)

membrane (ISO)

multivesicular body (IDA)

plasma membrane (IBA,IEA,ISO)

secretory granule (IDA)

vesicle membrane (IEA,ISO)

Molecular Function

5'-nucleotidase activity (IEA,ISO)

acid phosphatase activity (IBA,IDA,ISO)

choline binding (IDA)

identical protein binding (ISO)

lysophosphatidic acid phosphatase activity (IEA,ISO)

molecular adaptor activity (ISO)

phosphatase activity (ISO)

protein binding (ISO)

protein homodimerization activity (IDA,IEA,ISO)

protein tyrosine phosphatase activity (IEA)

thiamine phosphate phosphatase activity (IEA,ISO)

XMP 5'-nucleosidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

riboflavin metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Gene Data File	Integration of LocusLink data, October 12, 2001
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Human CTL epitopes prostatic acid phosphatase-3 and six-transmembrane epithelial antigen of prostate-3 as candidates for prostate cancer immunotherapy.	Machlenkin A, etal., Cancer Res. 2005 Jul 15;65(14):6435-42.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	[Acute Meckel's diverticulitis in a patient with a pseudomucinous cyst of the appendix]	Modzelewski B and Wasiak J, Pol Tyg Lek 1978 Aug 7;33(32):1257-8.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	[Osteosynthesis of the tubular bones using a polymeric pin].	Plakhotin MV, etal., Veterinariia. 1978 Dec;(12):89-90.
11.	Site-directed mutagenesis of prostatic acid phosphatase. Catalytically important aspartic acid 258, substrate specificity, and oligomerization.	Porvari KS, etal., J Biol Chem. 1994 Sep 9;269(36):22642-6.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Primary structure of rat secretory acid phosphatase and comparison to other acid phosphatases.	Roiko K, etal., Gene 1990 May 14;89(2):223-9.
16.	Prostate-specific antigen/prostatic acid phosphatase ratio is significant prognostic factor in patients with stage IV prostate cancer.	Saito T, etal., Urology. 2007 Oct;70(4):702-5.
17.	The cytochemical demonstration of prostatic acid phosphatase using a new substrate, phosphorylcholine.	Serrano JA, etal., J Histochem Cytochem. 1976 Oct;24(10):1046-56.
18.	Structural comparison of human and rat prostate-specific acid phosphatase genes and their promoters: identification of putative androgen response elements.	Virkkunen P, etal., Biochem Biophys Res Commun 1994 Jul 15;202(1):49-57.
19.	Transcriptional activation of the human prostatic acid phosphatase gene by NF-kappaB via a novel hexanucleotide-binding site.	Zelivianski S, etal., Nucleic Acids Res. 2004 Jul 7;32(12):3566-80. Print 2004.

Additional References at PubMed

PMID:8132635	PMID:8334986	PMID:8407898	PMID:10639192	PMID:15280042	PMID:15578709	PMID:17638863	PMID:17658863	PMID:17897319	PMID:18083097	PMID:18940592	PMID:19056867
PMID:20084276	PMID:21630459	PMID:22389722	PMID:23376485	PMID:23533145	PMID:24657436	PMID:25482440	PMID:25674224	PMID:27348306

Genomics

Comparative Map Data

Acp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	113,784,372 - 113,833,033 (-)	NCBI		GRCr8
mRatBN7.2	8	104,905,570 - 104,956,146 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	104,905,586 - 104,954,236 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	110,555,965 - 110,601,143 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	108,755,152 - 108,800,326 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	106,597,855 - 106,643,027 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	112,838,574 - 112,884,062 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	112,834,707 - 112,884,077 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	112,224,707 - 112,272,400 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	109,354,381 - 109,400,296 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	109,382,705 - 109,419,751 (-)	NCBI
Celera	8	104,274,154 - 104,317,190 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

ACP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	132,317,407 - 132,368,302 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	132,317,369 - 132,368,302 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	132,036,251 - 132,087,146 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	133,518,949 - 133,560,294 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	133,518,956 - 133,560,298	NCBI
Celera	3	130,462,489 - 130,513,425 (+)	NCBI		Celera
Cytogenetic Map	3	q22.1	ENTREZGENE
HuRef	3	129,415,425 - 129,466,393 (+)	NCBI		HuRef
CHM1_1	3	131,999,235 - 132,050,170 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	135,061,847 - 135,112,776 (+)	NCBI		T2T-CHM13v2.0

Acp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	104,165,439 - 104,214,921 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	104,165,450 - 104,214,947 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	104,288,240 - 104,337,722 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	104,288,251 - 104,337,748 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	104,190,570 - 104,240,052 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	104,146,585 - 104,196,067 (-)	NCBI		MGSCv36	mm8
Celera	9	103,840,497 - 103,890,048 (-)	NCBI		Celera
Cytogenetic Map	9	F1	NCBI
cM Map	9	56.61	NCBI

Acp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955501	6,164,152 - 6,218,967 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955501	6,168,083 - 6,218,934 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	130,267,935 - 130,324,616 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	130,272,663 - 130,330,166 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	129,392,396 - 129,465,962 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	136,713,816 - 136,764,655 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	136,713,816 - 136,764,655 (+)	Ensembl	panpan1.1		panPan2

ACP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	29,294,641 - 29,353,970 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	29,294,843 - 29,343,499 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	29,269,310 - 29,328,452 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	29,807,873 - 29,866,994 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	29,807,934 - 29,849,928 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	29,500,099 - 29,559,146 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	29,558,604 - 29,617,766 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	29,808,824 - 29,868,045 (+)	NCBI		UU_Cfam_GSD_1.0

Acp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	68,901,255 - 68,964,887 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	5,661,702 - 5,725,363 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936529	5,661,772 - 5,723,108 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	73,471,889 - 73,530,011 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	73,471,837 - 73,530,778 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	81,003,170 - 81,028,400 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	57,887,528 - 57,934,851 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	57,887,365 - 57,934,707 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	30,876,931 - 30,930,054 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	8,375,258 - 8,432,302 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	8,375,429 - 8,441,375 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Acp3
405 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	52
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000016222
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
631217	Activ1	Activity QTL 1	15.9		voluntary movement trait (VT:0003491)	number of photobeam interruptions in an experimental apparatus (CMO:0001517)	8	102370617	108923645	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	100149864	120994388	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat

Markers in Region

D8Wox15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	104,917,506 - 104,917,671 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	112,847,165 - 112,847,329	NCBI	Rnor6.0
Rnor_5.0	8	112,233,298 - 112,233,462	UniSTS	Rnor5.0
RGSC_v3.4	8	109,362,917 - 109,363,081	UniSTS	RGSC3.4
Celera	8	104,282,671 - 104,282,821	UniSTS
Cytogenetic Map	8	q32	UniSTS

BI283253

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	104,917,129 - 104,917,247 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	112,846,788 - 112,846,905	NCBI	Rnor6.0
Rnor_5.0	8	112,232,921 - 112,233,038	UniSTS	Rnor5.0
RGSC_v3.4	8	109,362,540 - 109,362,657	UniSTS	RGSC3.4
Celera	8	104,282,295 - 104,282,411	UniSTS
RH 3.4 Map	8	1155.3	UniSTS
Cytogenetic Map	8	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			2	2		2				2	7	3
Low	3	3	41	25	19	25	2	2	23	31	32	8	2
Below cutoff		39	14	14		14	6	8	41	2	2		6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_020072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ826426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M32397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016222 ⟹ ENSRNOP00000016222

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	104,917,841 - 104,954,236 (-)	Ensembl
Rnor_6.0 Ensembl	8	112,847,499 - 112,884,062 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085585 ⟹ ENSRNOP00000072975

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	104,905,586 - 104,954,236 (-)	Ensembl
Rnor_6.0 Ensembl	8	112,834,707 - 112,884,077 (-)	Ensembl

RefSeq Acc Id:

NM_001134901 ⟹ NP_001128373

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	113,785,032 - 113,833,033 (-)	NCBI
mRatBN7.2	8	104,906,244 - 104,954,245 (-)	NCBI
Rnor_6.0	8	112,838,629 - 112,884,022 (-)	NCBI
Rnor_5.0	8	112,224,707 - 112,272,400 (-)	NCBI
RGSC_v3.4	8	109,354,381 - 109,400,296 (-)	RGD
Celera	8	104,274,154 - 104,317,150 (-)	NCBI

Sequence:

show sequence

ATGAGAGCTGTCCCTCTGCACCTCGTCGGGACAGCAAGCCTCACCCTTGGCTTCTTGCTCCTGC
TATCTCTCCGCCTGGACCCAGGCCAAGCCAAGGAGTTGAAGTTTGTGACATTGGTGTTCCGGCA
TGGAGACCGAGGTCCCATCGAGACCTTTCCTAATGACCCCATTAAGGAATCCTCGTGGCCACAA
GGATTTGGCCAACTCACCAAGTGGGGCATGGGACAGCACTACGAACTCGGAAGTTATATAAGGA
GAAGATACGGGAGATTCTTGAACAACTCCTATAAACATGACCAGGTTTATATCCGAAGCACAGA
TGTTGACAGGACTCTGATGAGCGCTATGACAAACCTCGCAGCCCTGTTTCCCCCTGAGGGGATC
AGCATCTGGAATCCCAGACTGCTCTGGCAGCCCATCCCAGTGCACACCGTGTCTCTCTCTGAGG
ATCGGTTGCTATACCTGCCTTTCAGGGACTGTCCTCGCTTTCAAGAACTCAAGAGTGAGACTTT
GAAATCTGAGGAGTTCCTGAAGAGGCTTCAACCATATAAAAGCTTCATAGACACCTTGCCATCG
CTGTCGGGATTCGAGGACCAGGATCTTTTTGAAATCTGGAGTAGGCTTTACGACCCTTTATATT
GCGAGAGTGTTCACAATTTCACCTTGCCCACCTGGGCCACAGAGGACGCCATGACTAAGTTGAA
GGAGTTGTCAGAATTATCTCTGTTATCTCTTTATGGAATTCACAAGCAGAAAGAGAAATCTAGA
CTCCAGGGGGGCGTCCTGGTCAATGAAATTCTCAAGAACATGAAGCTTGCAACTCAACCACAGA
AGGCCAGGAAGTTGATCATGTATTCTGCACATGACACTACTGTGAGTGGCCTGCAGATGGCGCT
AGACGTTTATAATGGACTTCTACCTCCCTACGCTTCCTGCCACATAATGGAATTGTACCAGGAT
AATGGGGGGCACTTCGTGGAGATGTACTACCGGAATGAGACCCAGAACGAGCCCTACCCACTCA
CGCTGCCGGGCTGTACCCACAGCTGCCCTCTGGAGAAGTTTGCAGAGCTACTGGACCCCGTGAT
CCCCCAGGACTGGGCCACAGAGTGTATGGGCACAAGCAACCACCAAGTGCTGAGGGTCATCCTT
GCCACTACGTTTTGCCTGGTAACCGGGATCCTGGTGATATTGCTGCTTGTTCTCATCCGCCACG
GACCCTGCTGGCAGAGAGACGTGTATCGGAACATCTGA

hide sequence

RefSeq Acc Id:

NM_020072 ⟹ NP_064457

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	113,796,634 - 113,833,033 (-)	NCBI
mRatBN7.2	8	104,917,840 - 104,954,245 (-)	NCBI
Rnor_6.0	8	112,847,499 - 112,884,062 (-)	NCBI
Rnor_5.0	8	112,224,707 - 112,272,400 (-)	NCBI
RGSC_v3.4	8	109,354,381 - 109,400,296 (-)	RGD
Celera	8	104,282,991 - 104,317,190 (-)	NCBI

Sequence:

show sequence

CACCTCCTACAGCTGCCACAAGCAGCTCTCTTCCCCCACCATGAGAGCTGTCCCTCTGCACCTC
GTCGGGACAGCAAGCCTCACCCTTGGCTTCTTGCTCCTGCTATCTCTCCGCCTGGACCCAGGCC
AAGCCAAGGAGTTGAAGTTTGTGACATTGGTGTTCCGGCATGGAGACCGAGGTCCCATCGAGAC
CTTTCCTAATGACCCCATTAAGGAATCCTCGTGGCCACAAGGATTTGGCCAACTCACCAAGTGG
GGCATGGGACAGCACTACGAACTCGGAAGTTATATAAGGAGAAGATACGGGAGATTCTTGAACA
ACTCCTATAAACATGACCAGGTTTATATCCGAAGCACAGATGTTGACAGGACTCTGATGAGCGC
TATGACAAACCTCGCAGCCCTGTTTCCCCCTGAGGGGATCAGCATCTGGAATCCCAGACTGCTC
TGGCAGCCCATCCCAGTGCACACCGTGTCTCTCTCTGAGGATCGGTTGCTATACCTGCCTTTCA
GGGACTGTCCTCGCTTTCAAGAACTCAAGAGTGAGACTTTAAAATCTGAGGAGTTCCTGAAGAG
GCTTCAACCATATAAAAGCTTCATAGACACCTTGCCATCGCTGTCGGGATTCGAGGACCAGGAT
CTTTTTGAAATCTGGAGTAGGCTTTACGACCCTTTATATTGCGAGAGTGTTCACAATTTCACCT
TCCGCACCTGGGCCACAGAGGACGCCATGACTAAGTTGAAGGAGTTGTCAGAATTATCTCTGTT
ATCTCTTTATGGAATTCACAAGCAGAAAGAGAAATCTAGACTCCAGGGGGGCGTCCTGGTCAAT
GAAATTCTCAAGAACATGAAGCTTGCAACTCAACCACAGAAGGCCAGGAAGTTGATCATGTATT
CTGCATATGACACTACTGTGAGTGGCCTGCAGATGGCGCTAGAGCTTTATAATGGACTTCTACC
TCCCTACGCTTCCTGCCACATAATGGAATTGTACCAGGATAATGGGGGGACCTTCGTGGAGATG
TACTACCGGAATGAGACCCAGAACGAGCCCTACCCACTCACGCTGCCGGGCTGTACCCACAGCT
GCCCTCTGGAGAAGTTTGCAGAGCTACTGGACCCCGTGATCCCCCAGGACTGGGCCACAGAGTG
TATGGGCACAAGCAACCACCAAGCGTCGCTGTAAAAGAACAACCAGTTGCCAGTGTAATCAGGA
AAAGAGTTAGGTCAAACTTGTGGGTCTGCCGGGGATCCATGATTAGCACAAAGAACTCTATTGC
TGAAGGATTCGAAGATTTTGCTTGAGCGGGTGAGTAAAGCTGCCCTGGGAATGTCTGATGTAAA
AACAGGTTTCAGACGAAGCCTACCAAGTTAGCGTGCAAGCATGAAAAAGAAGACACTTATCCCA
GGCTAATGGGCAAAGGACCTGATTCACCTGACAACAACGCTCACCTGTTCCCCTGCCTTCTCTC
ACGAGGCAAAAAGATGAGACAGGAGGACACCTGGAGGAGTTTTCCATACCCAGCCTAGAACGAT
CAGATTTTATATGTATGTCAAAAGACGCTGGGTAGCAGAACTGAATAATAAAAGCCTCTTGGTG
TCC

hide sequence

RefSeq Acc Id:

XM_039082022 ⟹ XP_038937950

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	113,784,372 - 113,830,073 (-)	NCBI
mRatBN7.2	8	104,905,570 - 104,954,207 (-)	NCBI

RefSeq Acc Id:

XM_039082023 ⟹ XP_038937951

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	113,784,372 - 113,829,010 (-)	NCBI
mRatBN7.2	8	104,905,570 - 104,949,213 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001128373	(Get FASTA)	NCBI Sequence Viewer
	NP_064457	(Get FASTA)	NCBI Sequence Viewer
	XP_038937950	(Get FASTA)	NCBI Sequence Viewer
	XP_038937951	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41806	(Get FASTA)	NCBI Sequence Viewer
	ABH07387	(Get FASTA)	NCBI Sequence Viewer
	CAA52914	(Get FASTA)	NCBI Sequence Viewer
	EDL77357	(Get FASTA)	NCBI Sequence Viewer
	EDL77358	(Get FASTA)	NCBI Sequence Viewer
	EDL77359	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016222
	ENSRNOP00000016222.5
	ENSRNOP00000072975
	ENSRNOP00000072975.1
	ENSRNOP00055017899
	ENSRNOP00060010062
	ENSRNOP00065009263
GenBank Protein	P20646	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_064457 ⟸ NM_020072
- Peptide Label:	short isoform precursor
- UniProtKB:	P20646 (UniProtKB/Swiss-Prot), A6XJQ5 (UniProtKB/Swiss-Prot), A0A0G2JSL5 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MRAVPLHLVGTASLTLGFLLLLSLRLDPGQAKELKFVTLVFRHGDRGPIETFPNDPIKESSWPQ GFGQLTKWGMGQHYELGSYIRRRYGRFLNNSYKHDQVYIRSTDVDRTLMSAMTNLAALFPPEGI SIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRFQELKSETLKSEEFLKRLQPYKSFIDTLPS LSGFEDQDLFEIWSRLYDPLYCESVHNFTFRTWATEDAMTKLKELSELSLLSLYGIHKQKEKSR LQGGVLVNEILKNMKLATQPQKARKLIMYSAYDTTVSGLQMALELYNGLLPPYASCHIMELYQD NGGTFVEMYYRNETQNEPYPLTLPGCTHSCPLEKFAELLDPVIPQDWATECMGTSNHQASL hide sequence

RefSeq Acc Id:	NP_001128373 ⟸ NM_001134901
- Peptide Label:	long isoform precursor
- UniProtKB:	A0A0G2K4B4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRAVPLHLVGTASLTLGFLLLLSLRLDPGQAKELKFVTLVFRHGDRGPIETFPNDPIKESSWPQ GFGQLTKWGMGQHYELGSYIRRRYGRFLNNSYKHDQVYIRSTDVDRTLMSAMTNLAALFPPEGI SIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRFQELKSETLKSEEFLKRLQPYKSFIDTLPS LSGFEDQDLFEIWSRLYDPLYCESVHNFTLPTWATEDAMTKLKELSELSLLSLYGIHKQKEKSR LQGGVLVNEILKNMKLATQPQKARKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHIMELYQD NGGHFVEMYYRNETQNEPYPLTLPGCTHSCPLEKFAELLDPVIPQDWATECMGTSNHQVLRVIL ATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI hide sequence

RefSeq Acc Id:

ENSRNOP00000016222 ⟸ ENSRNOT00000016222

RefSeq Acc Id:

ENSRNOP00000072975 ⟸ ENSRNOT00000085585

RefSeq Acc Id:	XP_038937950 ⟸ XM_039082022
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038937951 ⟸ XM_039082023
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20646-F1-model_v2	AlphaFold	P20646	1-381	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696238

Promoter ID:

EPDNEW_R6762

Type:

multiple initiation site

Name:

Acpp_1

Description:

acid phosphatase, prostate

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	112,884,071 - 112,884,131	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2023	AgrOrtholog
BioCyc Gene	G2FUF-29288	BioCyc
Ensembl Genes	ENSRNOG00000011820	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055012887	UniProtKB/Swiss-Prot
	ENSRNOG00060008023	UniProtKB/Swiss-Prot
	ENSRNOG00065007977	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016222	ENTREZGENE
	ENSRNOT00000016222.6	UniProtKB/Swiss-Prot
	ENSRNOT00000085585	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000085585.2	UniProtKB/Swiss-Prot
	ENSRNOT00055022057	UniProtKB/Swiss-Prot
	ENSRNOT00060013250	UniProtKB/Swiss-Prot
	ENSRNOT00065012587	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1240	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Acid_Pase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	His_Pase_clade-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	His_PPase_superfam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:56780	UniProtKB/Swiss-Prot
NCBI Gene	Acp3	ENTREZGENE
PANTHER	ACID PHOSPHATASE-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROSTATIC ACID PHOSPHATASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	His_Phos_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Acp3	PhenoGen
PROSITE	HIS_ACID_PHOSPHAT_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HIS_ACID_PHOSPHAT_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011820	RatGTEx
	ENSRNOG00055012887	RatGTEx
	ENSRNOG00060008023	RatGTEx
	ENSRNOG00065007977	RatGTEx
Superfamily-SCOP	SSF53254	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JSL5	ENTREZGENE
	A0A0G2K4B4	ENTREZGENE, UniProtKB/TrEMBL
	A6XJQ5	ENTREZGENE
	P20646	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	A0A0G2JSL5	UniProtKB/Swiss-Prot
	A6XJQ5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-30	Acp3	acid phosphatase 3	Acpp	acid phosphatase, prostate	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Acpp	acid phosphatase, prostate			Symbol and Name updated	629477	APPROVED
2003-03-06	Acpp	acid phosphatase, prostate	Ppal	prostatic acid phosphatase (rPAP)	Data merged from RGD:620235	628472	PROVISIONAL
2002-08-07	Ppal	prostatic acid phosphatase (rPAP)			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Acpp	acid phosphatase, prostate			Symbol and Name status set to approved	70586	APPROVED
2001-06-12	Acpp	acid phosphatase, prostate			Symbol and Name updated to reflect Human and Mouse nomenclature	62408	APPROVED
2001-06-12	Acpp11	Prostatic acid phosphatase			Symbol and Name withdrawn	62408	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_expression	synthesized in prostate epithelial cells, released into prostatic fluid	69941
gene_expression	synthesized in prostate epithelial cells, released into prostatic fluid	70323
gene_function	hydrolyzes phosphomonoesters under acidic condition	69941
gene_function	hydrolyzes phosphomonoesters under acidic condition	70323
gene_physical_interaction	androgen receptor binds to two conserved regions, one in the proximal promoter and another in intron 1	69941
gene_physical_interaction	androgen receptor binds to two conserved regions, one in the proximal promoter and another in intron 1	70323
gene_product	cDNA 1626 nt long	69941
gene_product	cDNA 1626 nt long	70323
gene_product	contains 11 exons	69941
gene_product	contains 11 exons	70323
gene_regulation	regulated by androgen	69941
gene_regulation	regulated by androgen	70323
gene_transcript	three mRNA species (4.9, 2.3 and 1.5 kb) in prostate	69941
gene_transcript	three mRNA species (4.9, 2.3 and 1.5 kb) in prostate	70323

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)