Advanced Search (OLGA)

Gene: Pick1 (protein interacting with PRKCA 1) Rattus norvegicus

Analyze

Symbol:

Pick1

Name:

protein interacting with PRKCA 1

RGD ID:

69437

Description:

Enables several functions, including Arp2/3 complex binding activity; SNAP receptor activity; and glutamate receptor binding activity. Involved in several processes, including dendritic spine maintenance; long-term synaptic depression; and regulation of receptor internalization. Located in several cellular components, including dendritic spine; excitatory synapse; and postsynaptic density. Part of protein-containing complex. Is active in several cellular components, including glutamatergic synapse; postsynaptic endocytic zone; and synaptic vesicle. Orthologous to human PICK1 (protein interacting with PRKCA 1); PARTICIPATES IN protein kinase C (PKC) signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

PRKCA-binding protein; Prkcabp; protein interacting with C kinase 1; protein kinase C alpha binding protein; protein kinase C, alpha binding protein; protein kinase C-alpha-binding protein; protein that interacts with C kinase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PICK1 (protein interacting with PRKCA 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pick1 (protein interacting with C kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pick1 (protein interacting with PRKCA 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POLR2F (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PICK1 (protein interacting with PRKCA 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pick1 (protein interacting with PRKCA 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PICK1 (protein interacting with PRKCA 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PICK1 (protein interacting with PRKCA 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pick1 (protein interacting with PRKCA 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PICK1 (protein interacting with PRKCA 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pick1 (protein interacting with C kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pick1 (protein interacting with prkca 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57G11C.22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57G11C.22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PICK1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PICK1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pick1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pick1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,676,890 - 112,697,275 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	112,677,322 - 112,697,257 (+)	Ensembl				GRCr8
mRatBN7.2	7	110,796,623 - 110,816,850 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,797,117 - 110,816,848 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	112,545,653 - 112,564,970 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,769,189 - 114,788,506 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,738,549 - 114,757,866 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,465,472 - 120,484,824 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,465,130 - 120,484,840 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	120,459,118 - 120,478,470 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	117,213,299 - 117,232,651 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	107,131,151 - 107,150,407 (+)	NCBI		Celera
RGSC_v3.1	7	117,247,528 - 117,266,879 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amphetamine abuse (ISO)

substance-induced psychosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

3-nitropropanoic acid (EXP)

4,4'-sulfonyldiphenol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

Brodifacoum (EXP)

Butylbenzyl phthalate (EXP)

calcium atom (EXP)

calcium(0) (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

diazinon (EXP,ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

excitatory amino acid agonist (EXP)

fenthion (ISO)

gentamycin (EXP)

kainic acid (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methamphetamine (ISO)

methidathion (ISO)

methotrexate (ISO)

nicotine (ISO)

paracetamol (EXP,ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

temozolomide (ISO)

topiramate (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

AMPA glutamate receptor clustering (IMP)

cellular response to decreased oxygen levels (IMP)

cellular response to glucose starvation (IMP)

cellular response to glycine (IEP)

dendritic spine maintenance (IBA,IMP)

dendritic spine organization (IDA)

dopamine transport (NAS)

glial cell development (IMP)

intracellular protein transport (IBA)

long-term synaptic depression (IDA)

membrane fusion (IEA)

monoamine transport (IEA,ISO,ISS)

negative regulation of Arp2/3 complex-mediated actin nucleation (IDA)

negative regulation of gene expression (IMP)

positive regulation of AMPA glutamate receptor clustering (IMP)

positive regulation of receptor internalization (IBA,IDA)

protein insertion into plasma membrane (IMP)

protein phosphorylation (IDA)

protein targeting (ISO)

receptor clustering (IBA,IEA,IMP,ISO,ISS)

regulation of Arp2/3 complex-mediated actin nucleation (IBA)

regulation of insulin secretion (IEA,ISO)

regulation of kainate selective glutamate receptor signaling pathway (IMP)

regulation of postsynaptic neurotransmitter receptor internalization (IDA,IEP,IMP)

Cellular Component

cytoplasm (IEA,ISO,ISS)

cytoskeleton (IEA)

cytosol (IEA,ISO)

dendrite (IDA)

dendritic spine (IDA)

dendritic spine cytoplasm (IDA)

excitatory synapse (IDA)

glutamatergic synapse (IDA,IEP,IMP)

Golgi apparatus (ISO,ISS)

membrane (IEA)

mitochondrion (ISO)

neuron projection (IBA,IDA,IEA)

perinuclear region of cytoplasm (IDA,IEA,ISO,ISS)

plasma membrane (IEA,ISO,ISS,TAS)

postsynaptic density (IBA,IDA,IEA,ISO)

postsynaptic endocytic zone (IDA,IMP)

postsynaptic specialization (IDA)

presynaptic active zone cytoplasmic component (IDA)

presynaptic membrane (IEA,ISO,ISS)

protein-containing complex (IDA)

synapse (IDA,IEA,ISO,ISS)

synaptic vesicle (IBA,IDA)

trans-Golgi network membrane (IBA)

Molecular Function

actin binding (IEA)

actin filament binding (IDA)

Arp2/3 complex binding (IDA)

cytoskeletal protein binding (IPI)

ephrin receptor binding (TAS)

G protein-coupled glutamate receptor binding (IPI,TAS)

G protein-coupled receptor binding (IPI)

GTPase binding (TAS)

identical protein binding (IDA,IEA,IPI,ISO)

ionotropic glutamate receptor binding (IPI)

membrane curvature sensor activity (IEA,ISO)

metal ion binding (IEA)

phospholipid binding (IBA)

protein binding (IPI,ISO)

protein domain specific binding (IEA,IMP)

protein kinase C binding (IBA,IDA,IEA,ISO,ISS)

protein transporter activity (IMP)

receptor tyrosine kinase binding (TAS)

signaling receptor binding (ISO,ISS)

SNAP receptor activity (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

protein kinase C (PKC) signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	PICK1-ICA69 heteromeric BAR domain complex regulates synaptic targeting and surface expression of AMPA receptors.	Cao M, etal., J Neurosci. 2007 Nov 21;27(47):12945-56.
2.	Phosphorylation of the AMPA receptor subunit GluR2 differentially regulates its interaction with PDZ domain-containing proteins.	Chung HJ, etal., J Neurosci. 2000 Oct 1;20(19):7258-67.
3.	PICK1 interacts with and regulates PKC phosphorylation of mGLUR7.	Dev KK, etal., J Neurosci. 2000 Oct 1;20(19):7252-7.
4.	The protein kinase C alpha binding protein PICK1 interacts with short but not long form alternative splice variants of AMPA receptor subunits.	Dev KK, etal., Neuropharmacology. 1999 May;38(5):635-44.
5.	ASIC2b-dependent regulation of ASIC3, an essential acid-sensing ion channel subunit in sensory neurons via the partner protein PICK-1.	Deval E, etal., J Biol Chem 2004 May 7;279(19):19531-9. Epub 2004 Feb 19.
6.	The protein interacting with C-kinase (PICK1) interacts with and attenuates parkin-associated endothelial-like (PAEL) receptor-mediated cell death.	Dutta P, etal., J Neurochem. 2014 Aug;130(3):360-73. doi: 10.1111/jnc.12741. Epub 2014 May 19.
7.	Interaction of the C-terminal tail region of the metabotropic glutamate receptor 7 with the protein kinase C substrate PICK1.	El Far O, etal., Eur J Neurosci 2000 Dec;12(12):4215-21.
8.	PICK1 regulates AMPA receptor endocytosis via direct interactions with AP2 a-appendage and dynamin.	Fiuza M, etal., J Cell Biol. 2017 Oct 2;216(10):3323-3338. doi: 10.1083/jcb.201701034. Epub 2017 Aug 30.
9.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	Protein interacting with C kinase 1 (PICK1) and GluR2 are associated with presynaptic plasma membrane and vesicles in hippocampal excitatory synapses.	Haglerød C, etal., Neuroscience. 2009 Jan 12;158(1):242-52. doi: 10.1016/j.neuroscience.2008.11.029. Epub 2008 Nov 27.
12.	Presynaptic PICK1 facilitates trafficking of AMPA-receptors between active zone and synaptic vesicle pool.	Haglerød C, etal., Neuroscience. 2017 Mar 6;344:102-112. doi: 10.1016/j.neuroscience.2016.12.042. Epub 2017 Jan 3.
13.	NSF ATPase and alpha-/beta-SNAPs disassemble the AMPA receptor-PICK1 complex.	Hanley JG, etal., Neuron 2002 Mar 28;34(1):53-67.
14.	The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.	Hirbec H, etal., J Biol Chem. 2002 May 3;277(18):15221-4. Epub 2002 Mar 12.
15.	Rapid and differential regulation of AMPA and kainate receptors at hippocampal mossy fibre synapses by PICK1 and GRIP.	Hirbec H, etal., Neuron. 2003 Feb 20;37(4):625-38. doi: 10.1016/s0896-6273(02)01191-1.
16.	PICK1 mediates transient synaptic expression of GluA2-lacking AMPA receptors during glycine-induced AMPA receptor trafficking.	Jaafari N, etal., J Neurosci. 2012 Aug 22;32(34):11618-30. doi: 10.1523/JNEUROSCI.5068-11.2012.
17.	Brain-derived neurotrophic factor signal enhances and maintains the expression of AMPA receptor-associated PDZ proteins in developing cortical neurons.	Jourdi H, etal., Dev Biol. 2003 Nov 15;263(2):216-30. doi: 10.1016/j.ydbio.2003.07.008.
18.	Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering.	Karlsen ML, etal., Structure. 2015 Jul 7;23(7):1258-70. doi: 10.1016/j.str.2015.04.020. Epub 2015 Jun 11.
19.	Mitogen-stimulated TIS21 protein interacts with a protein-kinase-Calpha-binding protein rPICK1.	Lin WJ, etal., Biochem J 2001 Mar 15;354(Pt 3):635-43.
20.	PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.	Lu W and Ziff EB, Neuron. 2005 Aug 4;47(3):407-21.
21.	Molecular determinants for the complex binding specificity of the PDZ domain in PICK1.	Madsen KL, etal., J Biol Chem. 2005 May 27;280(21):20539-48. Epub 2005 Mar 17.
22.	Immunolocalization of PICK1 in the ascending auditory pathways of the adult rat.	McInvale AC, etal., J Comp Neurol 2002 Sep 2;450(4):382-94.
23.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
24.	The antagonistic modulation of Arp2/3 activity by N-WASP, WAVE2 and PICK1 defines dynamic changes in astrocyte morphology.	Murk K, etal., J Cell Sci. 2013 Sep 1;126(Pt 17):3873-83. doi: 10.1242/jcs.125146. Epub 2013 Jul 10.
25.	PICK1 inhibition of the Arp2/3 complex controls dendritic spine size and synaptic plasticity.	Nakamura Y, etal., EMBO J. 2011 Feb 16;30(4):719-30. doi: 10.1038/emboj.2010.357. Epub 2011 Jan 21.
26.	Clustering and synaptic targeting of PICK1 requires direct interaction between the PDZ domain and lipid membranes.	Pan L, etal., EMBO J. 2007 Oct 31;26(21):4576-87. Epub 2007 Oct 4.
27.	PICK1 targets activated protein kinase Calpha to AMPA receptor clusters in spines of hippocampal neurons and reduces surface levels of the AMPA-type glutamate receptor subunit 2.	Perez JL, etal., J Neurosci. 2001 Aug 1;21(15):5417-28. doi: 10.1523/JNEUROSCI.21-15-05417.2001.
28.	GOA pipeline	RGD automated data pipeline
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	Inhibition of Arp2/3-mediated actin polymerization by PICK1 regulates neuronal morphology and AMPA receptor endocytosis.	Rocca DL, etal., Nat Cell Biol. 2008 Mar;10(3):259-71. doi: 10.1038/ncb1688. Epub 2008 Feb 24.
31.	The small GTPase Arf1 modulates Arp2/3-mediated actin polymerization via PICK1 to regulate synaptic plasticity.	Rocca DL, etal., Neuron. 2013 Jul 24;79(2):293-307. doi: 10.1016/j.neuron.2013.05.003.
32.	NMDA receptors mediate calcium-dependent, bidirectional changes in dendritic PICK1 clustering.	Sossa KG, etal., Mol Cell Neurosci. 2006 Mar;31(3):574-85. Epub 2006 Jan 10.
33.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
34.	Identification of a small-molecule inhibitor of the PICK1 PDZ domain that inhibits hippocampal LTP and LTD.	Thorsen TS, etal., Proc Natl Acad Sci U S A. 2010 Jan 5;107(1):413-8. doi: 10.1073/pnas.0902225107. Epub 2009 Dec 14.
35.	PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.	Torres R, etal., Neuron. 1998 Dec;21(6):1453-63.
36.	Protein scaffolds, lipid domains and substrate recognition in protein kinase C function: implications for rational drug design.	Walker JW Handb Exp Pharmacol. 2008;(186):185-203.
37.	Clustering of AMPA receptors by the synaptic PDZ domain-containing protein PICK1.	Xia J, etal., Neuron 1999 Jan;22(1):179-87.

Additional References at PubMed

PMID:7844141	PMID:9405395	PMID:10567402	PMID:10623590	PMID:11343649	PMID:11375398	PMID:12526085	PMID:12826667	PMID:14672991	PMID:15190111	PMID:15458844	PMID:15895086
PMID:16314870	PMID:17302911	PMID:18184314	PMID:18429931	PMID:18466293	PMID:18492472	PMID:18755154	PMID:19321442	PMID:19644508	PMID:20403402	PMID:21176140	PMID:21527319
PMID:22129425	PMID:22624977	PMID:23697999	PMID:23823934	PMID:23918399	PMID:24069373	PMID:24831007	PMID:25392508	PMID:25475687	PMID:26306493	PMID:26702130	PMID:26868290
PMID:28404816	PMID:28888867	PMID:28951554	PMID:29768204	PMID:30605082

Genomics

Comparative Map Data

Pick1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,676,890 - 112,697,275 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	112,677,322 - 112,697,257 (+)	Ensembl				GRCr8
mRatBN7.2	7	110,796,623 - 110,816,850 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,797,117 - 110,816,848 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	112,545,653 - 112,564,970 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,769,189 - 114,788,506 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,738,549 - 114,757,866 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,465,472 - 120,484,824 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,465,130 - 120,484,840 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	120,459,118 - 120,478,470 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	117,213,299 - 117,232,651 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	107,131,151 - 107,150,407 (+)	NCBI		Celera
RGSC_v3.1	7	117,247,528 - 117,266,879 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

PICK1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	38,057,255 - 38,075,701 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	38,056,311 - 38,075,719 (+)	Ensembl			hg38	GRCh38
GRCh37	22	38,453,262 - 38,471,708 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	36,783,208 - 36,801,654 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	36,777,902 - 36,796,207	NCBI
Celera	22	22,255,002 - 22,273,457 (+)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	21,417,897 - 21,436,386 (+)	NCBI		HuRef
CHM1_1	22	38,411,992 - 38,430,442 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	38,518,878 - 38,537,327 (+)	NCBI		T2T-CHM13v2.0

Pick1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	79,113,373 - 79,133,666 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	79,113,373 - 79,133,684 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	79,229,140 - 79,249,466 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	79,229,173 - 79,249,484 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	79,059,604 - 79,079,896 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	79,057,068 - 79,076,715 (+)	NCBI		MGSCv36	mm8
Celera	15	81,348,804 - 81,369,231 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.7	NCBI

Pick1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	24,383,130 - 24,399,196 (+)	Ensembl
ChiLan1.0	NW_004955413	24,383,130 - 24,399,092 (+)	NCBI	ChiLan1.0	ChiLan1.0

POLR2F
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	47,812,190 - 47,900,125 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	50,500,550 - 50,602,004 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	18,868,872 - 18,988,918 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	36,796,053 - 36,814,464 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	36,796,015 - 36,814,469 (+)	Ensembl			panPan2	panpan1.1

PICK1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	26,595,301 - 26,614,170 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	26,595,768 - 26,613,756 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	26,550,611 - 26,569,400 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	27,387,103 - 27,406,123 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	27,387,124 - 27,406,155 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	27,107,123 - 27,126,143 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	27,418,687 - 27,437,706 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	27,595,780 - 27,614,797 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pick1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	10,087,798 - 10,105,588 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	3,097,629 - 3,116,526 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	3,098,196 - 3,115,921 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PICK1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	9,808,451 - 9,825,539 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	9,808,444 - 9,829,677 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	7,208,317 - 7,225,652 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PICK1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	20,758,199 - 20,778,210 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	20,759,960 - 20,779,514 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	104,992,571 - 105,011,487 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pick1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	9,880,670 - 9,895,230 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	9,880,773 - 9,895,270 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Pick1
112 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	89
Count of miRNA genes:	68
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000016077
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF327562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF373289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF542094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ240083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016077 ⟹ ENSRNOP00000016077

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	112,677,322 - 112,697,257 (+)	Ensembl
mRatBN7.2 Ensembl	7	110,797,117 - 110,816,848 (+)	Ensembl
Rnor_6.0 Ensembl	7	120,465,130 - 120,484,840 (+)	Ensembl

RefSeq Acc Id:

NM_053460 ⟹ NP_445912

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,677,545 - 112,697,275 (+)	NCBI
mRatBN7.2	7	110,797,117 - 110,816,848 (+)	NCBI
Rnor_6.0	7	120,465,472 - 120,484,824 (+)	NCBI
Rnor_5.0	7	120,459,118 - 120,478,470 (+)	NCBI
RGSC_v3.4	7	117,213,299 - 117,232,651 (+)	RGD
Celera	7	107,131,151 - 107,150,407 (+)	RGD

Sequence:

show sequence

CACGCGTCCGGGCAGACCCAGTTTCCTATTCCCCTCCCGAACTGGGCAGTTAGCCAGTCGGCCC
CAGCTCTCGGAACCATGTTTGCAGACTTAGACTATGACATCGAGGAGGATAAATTAGGAATCCC
CACTGTGCCCGGGAAGGTCACCCTGCAGAAGGATGCTCAGAACCTGATTGGCATCAGCATCGGA
GGAGGGGCCCAGTACTGTCCTTGTCTCTACATTGTCCAGGTATTTGATAACACGCCTGCAGCCT
TGGACGGCACTGTGGCAGCTGGTGATGAGATCACTGGGGTCAATGGCCGATCAATCAAAGGAAA
AACCAAGGTAGAGGTGGCGAAGATGATTCAGGAGGTGAAGGGGGAGGTGACCATCCATTACAAC
AAGCTGCAGGCGGACCCTAAGCAGGGCATGTCCCTGGACATTGTGTTGAAGAAAGTCAAGCACC
GGCTGGTAGAAAACATGAGTTCAGGCACAGCTGATGCCCTGGGTCTAAGCCGTGCCATCCTGTG
TAATGATGGGTTGGTAAAGCGGCTGGAGGAGCTGGAGCGCACTGCCGAGCTGTACAAAGGAATG
ACGGAGCACACCAAGAATCTCCTACGGGCCTTTTATGAGCTGTCACAGACTCACCGGGCTTTTG
GGGACGTGTTCTCTGTGATTGGGGTGCGGGAGCCGCAGCCAGCAGCAAGTGAAGCATTTGTGAA
GTTTGCTGACGCACACCGCAGCATTGAGAAGTTCGGCATTCGGCTACTGAAAACCATCAAACCG
ATGCTGACGGATCTGAACACGTACCTCAATAAGGCCATCCCTGATACACGCCTCACCATCAAGA
AGTACCTGGATGTGAAGTTTGAGTACTTGTCATACTGTCTGAAGGTGAAGGAGATGGACGACGA
GGAGTACAGCTGCATTGCCCTAGGAGAGCCGCTATACCGAGTGAGCACAGGCAACTATGAGTAC
CGCCTTATCCTGCGCTGCCGCCAGGAGGCTCGAGCCCGCTTCTCCCAGATGCGCAAGGATGTGC
TGGAGAAGATGGAGCTGCTGGACCAGAAGCACGTCCAGGACATCGTGTTCCAGCTGCAGCGCTT
CGTGTCTACCATGTCCAAGTACTATAATGACTGCTATGCGGTGCTGCGGGACGCCGACGTCTTC
CCCATCGAGGTGGACCTGGCACACACCACTCTAGCCTACGGCCCTAACCAGGGCGGCTTTACCG
ATGGCGAAGATGAGGAGGAGGAGGAGGAGGACGGGGCAGCTAGGGAAGTGTCCAAGGACGCACG
TGGGGCCACTGGGCCTACAGACAAGGGCGGAAGCTGGTGTGACTCCTGAGTGCCCCCCTCAAGT
GGACCTGGGGGCAGGGTAGTGGGAGGACCGCAGTGGGAGTGGGGCCGGGCCACTGTAGGACAGC
GAAGGCATATAGTGGCGCATAAAAGCCTGCTGGCTCGGGGCGCCTGCCTCCCTGCTCCTCTGTC
CTTGAACAGTGAACCCAGCCTGCAGCCTGGGACCTGGACTCTAGCCCCCATCCTTCCTTCCCAC
CTCCCAGCTAGAGGGAGAGCTGGGCCTTGGACAGAAAGAGAAGGGGCTGGAGCAGGCAGAGCAC
AGGACCTGTCCCTGTCCCTGTGAGCACCTCGGTGGTGCCACGCCTGCAGGGAATGGGAGCTGGG
TGGACATCCGAGGCTGTGACCAGTGTACCAGGGCGGCCCCCTGAGTCCATGTGCACACCTCGGC
AGCCTATATTTATTTGTTTCTGGCTTAGCCTCAAGGGCTGGAAGCTGGGCCTGTATTGAATAAA
CAGAAACCCAGACAGAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039079986 ⟹ XP_038935914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,676,890 - 112,697,259 (+)	NCBI
mRatBN7.2	7	110,796,657 - 110,816,850 (+)	NCBI

RefSeq Acc Id:

XM_063264344 ⟹ XP_063120414

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,687,935 - 112,697,259 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_445912	(Get FASTA)	NCBI Sequence Viewer
	XP_038935914	(Get FASTA)	NCBI Sequence Viewer
	XP_063120414	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG48152	(Get FASTA)	NCBI Sequence Viewer
	AAH72689	(Get FASTA)	NCBI Sequence Viewer
	AAK54603	(Get FASTA)	NCBI Sequence Viewer
	AAO49507	(Get FASTA)	NCBI Sequence Viewer
	CAC17808	(Get FASTA)	NCBI Sequence Viewer
	EDM15813	(Get FASTA)	NCBI Sequence Viewer
	EDM15814	(Get FASTA)	NCBI Sequence Viewer
	EDM15815	(Get FASTA)	NCBI Sequence Viewer
	EDM15816	(Get FASTA)	NCBI Sequence Viewer
	EDM15817	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016077
GenBank Protein	Q9EP80	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445912 ⟸ NM_053460

- UniProtKB:

Q9EP80 (UniProtKB/Swiss-Prot), Q925D1 (UniProtKB/Swiss-Prot), Q546X4 (UniProtKB/Swiss-Prot), Q6GQQ2 (UniProtKB/TrEMBL), A6HSQ7 (UniProtKB/TrEMBL), A6HSQ5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTV
AAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVEN
MSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFS
VIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDV
KFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKME
LLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGGFTDGEDE
EEEEEDGAAREVSKDARGATGPTDKGGSWCDS

hide sequence

Ensembl Acc Id:

ENSRNOP00000016077 ⟸ ENSRNOT00000016077

RefSeq Acc Id:	XP_038935914 ⟸ XM_039079986
- Peptide Label:	isoform X1
- UniProtKB:	Q9EP80 (UniProtKB/Swiss-Prot), Q925D1 (UniProtKB/Swiss-Prot), Q546X4 (UniProtKB/Swiss-Prot), Q6GQQ2 (UniProtKB/TrEMBL), A6HSQ7 (UniProtKB/TrEMBL), A6HSQ5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063120414 ⟸ XM_063264344
- Peptide Label:	isoform X2
- UniProtKB:	A6HSQ8 (UniProtKB/TrEMBL)

Protein Domains

AH PDZ

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EP80-F1-model_v2	AlphaFold	Q9EP80	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695478

Promoter ID:

EPDNEW_R6003

Type:

initiation region

Name:

Pick1_1

Description:

protein interacting with PRKCA 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	120,465,118 - 120,465,178	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69437	AgrOrtholog
BIND	130432
	144347
	144355
BioCyc Gene	G2FUF-32768	BioCyc
Ensembl Genes	ENSRNOG00000011507	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000016077	ENTREZGENE
Gene3D-CATH	1.20.1270.60	UniProtKB/Swiss-Prot
	2.30.42.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7105747	IMAGE-MGC_LOAD
InterPro	AH/BAR_dom_sf	UniProtKB/Swiss-Prot
	AH_dom	UniProtKB/Swiss-Prot
	Arfaptin_fam	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
	PDZ_sf	UniProtKB/Swiss-Prot
	PICK1_BAR	UniProtKB/Swiss-Prot
KEGG Report	rno:84591	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91578	IMAGE-MGC_LOAD
NCBI Gene	84591	ENTREZGENE
PANTHER	PRKCA-BINDING PROTEIN	UniProtKB/Swiss-Prot
	PTHR12141	UniProtKB/Swiss-Prot
Pfam	Arfaptin	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
PhenoGen	Pick1	PhenoGen
PROSITE	PDZ	UniProtKB/Swiss-Prot
	PS50870	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011507	RatGTEx
SMART	Arfaptin	UniProtKB/Swiss-Prot
	PDZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF103657	UniProtKB/Swiss-Prot
	SSF50156	UniProtKB/Swiss-Prot
UniProt	A6HSQ5	ENTREZGENE, UniProtKB/TrEMBL
	A6HSQ7	ENTREZGENE, UniProtKB/TrEMBL
	A6HSQ8	ENTREZGENE, UniProtKB/TrEMBL
	A6HSQ9_RAT	UniProtKB/TrEMBL
	PICK1_RAT	UniProtKB/Swiss-Prot
	Q546X4	ENTREZGENE
	Q6GQQ2	ENTREZGENE
	Q925D1	ENTREZGENE
	Q9EP80	ENTREZGENE
UniProt Secondary	Q546X4	UniProtKB/Swiss-Prot
	Q925D1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	Pick1	protein interacting with PRKCA 1	Pick1	protein interacting with C kinase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Pick1	protein interacting with C kinase 1	Prkcabp	protein kinase C, alpha binding protein	Symbol and Name updated	1299863	APPROVED
2004-09-10	Prkcabp	protein kinase C, alpha binding protein	Pick1	protein that interacts with C kinase 1	Symbol and Name updated	1299863	APPROVED
2002-06-10	Pick1	protein that interacts with C kinase 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the dorsal cochlear nucleus, anteroventral cochlear nucleus, posteroventral cochlear nucleus, some divisions of the superior olivary complex, inferior colliculus, medial geniculate body, and primary auditory cortex	1299219
gene_function	interacts with the C-terminal tail region of various receptors	1299218
gene_mutations_overexpression	mutation in the carboxylate-binding loop in the PDZ domain abolishes its binding to PKC-alpha	68719
gene_mutations_overexpression	mutation in the carboxylate-binding loop in the PDZ domain abolishes its binding to PKC-alpha	69384
gene_physical_interaction	binds protein kinase C-alpha (Prkca) and B-cell translocation gene 2 (Btg2) through a PDZ domain	68719
gene_physical_interaction	binds protein kinase C-alpha (Prkca) and B-cell translocation gene 2 (Btg2) through a PDZ domain	69384
gene_physical_interaction	interacts with the C-terminal tail region of mGluR7	1299218
gene_process	induces clustering of EphB2 receptor and AMPA (a-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptors involved in synaptic transmission	68719
gene_process	induces clustering of EphB2 receptor and AMPA (a-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptors involved in synaptic transmission	69384
gene_process	may act as an intracellular receptor for protein kinase C and modulate Btg2 phosphorylation	68719
gene_process	may act as an intracellular receptor for protein kinase C and modulate Btg2 phosphorylation	69384
gene_process	may regulate PKCalpha and GluR2 localization in components of the rat auditory system	1299219

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations