Symbol:
Park7
Name:
Parkinsonism associated deglycase
RGD ID:
621808
Description:
Predicted to enable several functions, including enzyme activator activity; enzyme binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of NMDA glutamate receptor activity; negative regulation of vascular associated smooth muscle cell proliferation; and positive regulation of fertilization. Located in several cellular components, including endoplasmic reticulum; mitochondrion; and sperm head. Used to study Parkinson's disease and Parkinsonism. Biomarker of Parkinsonism. Human ortholog(s) of this gene implicated in Parkinson's disease; Parkinson's disease 7; Parkinsonism; cerebral infarction; and middle cerebral artery infarction. Orthologous to human PARK7 (Parkinsonism associated deglycase); PARTICIPATES IN transforming growth factor-beta signaling pathway; Parkinson's disease pathway; INTERACTS WITH 1-bromopropane; 15-deoxy-Delta(12,14)-prostaglandin J2; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CAP1; contraception-associated protein 1; DJ-1; Dj1; fertility protein SP22; maillard deglycase; Parkinson disease (autosomal recessive, early onset) 7; parkinson disease protein 7 homolog; parkinson protein 7; protein/nucleic acid deglycase DJ-1; SP22
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Park7-ps1
Park7-ps2
Park7-ps3
Allele / Splice:
Park7em1Sage
Genetic Models:
LE-Park7em1Sage-/-
LE-Park7em1Sage
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,636,551 - 166,659,825 (-) NCBI GRCr8 mRatBN7.2 5 161,353,718 - 161,376,993 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,353,719 - 161,376,970 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,071,138 - 164,094,398 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,887,564 - 165,910,960 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,849,775 - 165,873,035 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 167,982,438 - 168,004,724 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 167,982,439 - 168,004,724 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,050,149 - 168,061,616 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 168,060,336 - 168,071,804 (-) NCBI Celera 5 159,607,648 - 159,630,713 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Park7 Rat (-)-epigallocatechin 3-gallate decreases expression ISO Park7 (Mus musculus) 6480464 epigallocatechin gallate results in decreased expression of PARK7 mRNA CTD PMID:25585349 Park7 Rat (1->4)-beta-D-glucan multiple interactions ISO Park7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PARK7 mRNA CTD PMID:36331819 Park7 Rat (R,R,R)-alpha-tocopherol multiple interactions ISO PARK7 (Homo sapiens) 6480464 alpha-Tocopherol inhibits the reaction [Rotenone affects the localization of PARK7 protein] CTD PMID:16439141 Park7 Rat (S)-nicotine multiple interactions ISO Park7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Park7 Rat 1,2-dimethylhydrazine multiple interactions ISO Park7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PARK7 mRNA CTD PMID:22206623 Park7 Rat 1-bromopropane decreases expression EXP 6480464 1-bromopropane results in decreased expression of PARK7 protein CTD PMID:21925529 Park7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to 1-Methyl-4-phenyl-1 more ... CTD PMID:15784737 Park7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Park7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 and PMID:22511790 Park7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Park7 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Park7 Rat 15-deoxy-Delta(12,14)-prostaglandin J2 multiple interactions EXP 6480464 15-deoxy-delta(12 more ... CTD PMID:22245093 Park7 Rat 17beta-estradiol decreases expression ISO Park7 (Mus musculus) 6480464 Estradiol results in decreased expression of PARK7 mRNA CTD PMID:39298647 Park7 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO PARK7 (Homo sapiens) 6480464 Metribolone results in increased expression of PARK7 protein CTD PMID:17152098 Park7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Park7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PARK7 mRNA CTD PMID:21570461 Park7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PARK7 mRNA CTD PMID:32109520 and PMID:34747641 Park7 Rat 2,6-dimethoxyphenol multiple interactions ISO PARK7 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Park7 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO PARK7 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of PARK7 protein CTD PMID:32044396 Park7 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of PARK7 protein and alpha-Chlorohydrin results in increased expression of PARK7 protein CTD PMID:26072098 and PMID:26597043 Park7 Rat 3-chloropropane-1,2-diol increases oxidation ISO Park7 (Mus musculus) 6480464 alpha-Chlorohydrin results in increased oxidation of PARK7 protein CTD PMID:31712104 Park7 Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin affects the expression of PARK7 protein CTD PMID:26072098 Park7 Rat 4,4'-sulfonyldiphenol increases expression ISO Park7 (Mus musculus) 6480464 bisphenol S results in increased expression of PARK7 mRNA CTD PMID:39298647 Park7 Rat 4,4'-sulfonyldiphenol increases expression ISO PARK7 (Homo sapiens) 6480464 bisphenol S results in increased expression of PARK7 protein CTD PMID:34186270 Park7 Rat 4-phenylbutyric acid increases expression EXP 6480464 4-phenylbutyric acid results in increased expression of PARK7 protein CTD PMID:21372141 Park7 Rat 4-phenylbutyric acid multiple interactions ISO PARK7 (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:17459145 Park7 Rat 4-phenylbutyric acid multiple interactions ISO Park7 (Mus musculus) 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:17459145 Park7 Rat 4-phenylbutyric acid increases expression ISO PARK7 (Homo sapiens) 6480464 4-phenylbutyric acid results in increased expression of PARK7 mRNA and 4-phenylbutyric acid results in increased expression of PARK7 protein CTD PMID:21372141 Park7 Rat 4-phenylbutyric acid multiple interactions EXP 6480464 [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Hydrogen Peroxide and [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Oxidopamine CTD PMID:21372141 Park7 Rat 4-phenylbutyric acid increases expression ISO Park7 (Mus musculus) 6480464 4-phenylbutyric acid results in increased expression of PARK7 protein CTD PMID:21372141 Park7 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PARK7 mRNA CTD PMID:24780913 Park7 Rat amiodarone increases expression ISO Park7 (Mus musculus) 6480464 Amiodarone results in increased expression of PARK7 mRNA CTD PMID:24489787 Park7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PARK7 mRNA CTD PMID:16483693 Park7 Rat amphetamine affects response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein affects the susceptibility to Amphetamine CTD PMID:15784737 Park7 Rat arsane multiple interactions ISO PARK7 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PARK7 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 Park7 Rat arsenic atom multiple interactions ISO PARK7 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PARK7 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 Park7 Rat arsenic trichloride multiple interactions ISO PARK7 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PARK7 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 Park7 Rat arsenite(3-) increases expression ISO Park7 (Mus musculus) 6480464 arsenite results in increased expression of PARK7 protein CTD PMID:37955338 Park7 Rat arsenite(3-) multiple interactions ISO PARK7 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PARK7 mRNA] CTD PMID:32406909 Park7 Rat astemizole increases expression EXP 6480464 Astemizole results in increased expression of PARK7 mRNA CTD PMID:20221588 Park7 Rat benomyl decreases activity ISO PARK7 (Homo sapiens) 6480464 Benomyl results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat benzene decreases expression ISO PARK7 (Homo sapiens) 6480464 Benzene results in decreased expression of PARK7 mRNA CTD PMID:16188089 Park7 Rat benzo[a]pyrene affects methylation ISO PARK7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PARK7 5' UTR CTD PMID:27901495 Park7 Rat benzo[a]pyrene decreases expression ISO PARK7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PARK7 mRNA CTD PMID:34332006 Park7 Rat beta-lapachone decreases expression ISO PARK7 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PARK7 mRNA CTD PMID:38218311 Park7 Rat bis(2-ethylhexyl) phthalate increases expression ISO Park7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PARK7 mRNA CTD PMID:33754040 Park7 Rat bisphenol A affects localization ISO Park7 (Mus musculus) 6480464 bisphenol A affects the localization of PARK7 protein CTD PMID:23037695 Park7 Rat bisphenol A decreases expression ISO Park7 (Mus musculus) 6480464 bisphenol A results in decreased expression of PARK7 mRNA CTD PMID:35598803 Park7 Rat bisphenol A increases methylation ISO PARK7 (Homo sapiens) 6480464 bisphenol A results in increased methylation of PARK7 gene CTD PMID:31601247 Park7 Rat bisphenol A increases expression ISO PARK7 (Homo sapiens) 6480464 bisphenol A results in increased expression of PARK7 protein CTD PMID:33670352 and PMID:37567409 Park7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PARK7 mRNA CTD PMID:33296240 Park7 Rat bisphenol A affects expression ISO PARK7 (Homo sapiens) 6480464 bisphenol A affects the expression of PARK7 mRNA CTD PMID:30903817 Park7 Rat bisphenol A multiple interactions ISO PARK7 (Homo sapiens) 6480464 bisphenol A promotes the reaction [PARK7 protein binds to ESR1 protein] CTD PMID:27156127 Park7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PARK7 mRNA CTD PMID:25181051 Park7 Rat bisphenol AF increases expression ISO PARK7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PARK7 protein CTD PMID:34186270 Park7 Rat bisphenol F decreases expression ISO Park7 (Mus musculus) 6480464 bisphenol F results in decreased expression of PARK7 mRNA CTD PMID:38685157 Park7 Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to PARK7 protein CTD PMID:17305373 Park7 Rat butyric acid increases expression ISO PARK7 (Homo sapiens) 6480464 Butyric Acid results in increased expression of PARK7 mRNA and Butyric Acid results in increased expression of PARK7 protein CTD PMID:21372141 Park7 Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of PARK7 protein CTD PMID:21372141 Park7 Rat butyric acid increases expression ISO Park7 (Mus musculus) 6480464 Butyric Acid results in increased expression of PARK7 protein CTD PMID:21372141 Park7 Rat cadmium atom multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PARK7 mRNA CTD PMID:35301059 Park7 Rat cadmium dichloride decreases expression ISO PARK7 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PARK7 protein CTD PMID:24419708 Park7 Rat cadmium dichloride multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PARK7 mRNA CTD PMID:35301059 Park7 Rat cannabidiol multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of PARK7 protein CTD PMID:34122009 Park7 Rat captan decreases activity ISO PARK7 (Homo sapiens) 6480464 Captan results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat CCCP multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 gene mutant form promotes the reaction [Carbonyl Cyanide m-Chlorophenyl Hydrazone affects the localization of PRKN protein] CTD PMID:22872702 Park7 Rat CGP 52608 multiple interactions ISO PARK7 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PARK7 gene] CTD PMID:28238834 Park7 Rat chlorpyrifos increases expression ISO Park7 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PARK7 mRNA CTD PMID:29156651 Park7 Rat chlorpyrifos decreases expression ISO Park7 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PARK7 mRNA CTD PMID:37019170 Park7 Rat chromium trinitrate increases expression ISO Park7 (Mus musculus) 6480464 chromium nitrate results in increased expression of PARK7 protein CTD PMID:22144121 Park7 Rat chromium(6+) affects expression ISO Park7 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PARK7 mRNA CTD PMID:28472532 Park7 Rat cisplatin multiple interactions ISO Park7 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of PARK7 mRNA more ... CTD PMID:24865317 and PMID:36965608 Park7 Rat cisplatin decreases expression ISO PARK7 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PARK7 protein CTD PMID:25450742 Park7 Rat cisplatin decreases expression ISO Park7 (Mus musculus) 6480464 Cisplatin results in decreased expression of PARK7 mRNA and Cisplatin results in decreased expression of PARK7 protein CTD PMID:21151649 more ... Park7 Rat clozapine increases expression ISO Park7 (Mus musculus) 6480464 Clozapine results in increased expression of PARK7 mRNA CTD PMID:14647396 Park7 Rat cobalt dichloride decreases expression ISO PARK7 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PARK7 mRNA CTD PMID:19376846 Park7 Rat copper atom affects binding ISO PARK7 (Homo sapiens) 6480464 Copper binds to PARK7 protein CTD PMID:23792957 Park7 Rat copper atom multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 Park7 Rat copper(0) affects binding ISO PARK7 (Homo sapiens) 6480464 Copper binds to PARK7 protein CTD PMID:23792957 Park7 Rat copper(0) multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 Park7 Rat crocidolite asbestos affects expression ISO PARK7 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of PARK7 mRNA CTD PMID:17331233 Park7 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PARK7 mRNA CTD PMID:27523638 Park7 Rat Cuprizon multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of PARK7 protein CTD PMID:34122009 Park7 Rat DDE decreases activity ISO PARK7 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat dexamethasone decreases expression ISO Park7 (Mus musculus) 6480464 Dexamethasone results in decreased expression of PARK7 protein CTD PMID:33567340 Park7 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of PARK7 mRNA CTD PMID:21968025 Park7 Rat diazinon decreases activity ISO PARK7 (Homo sapiens) 6480464 Diazinon results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat dibenziodolium multiple interactions ISO Park7 (Mus musculus) 6480464 diphenyleneiodonium inhibits the reaction [Lipopolysaccharides results in increased expression of PARK7 protein] CTD PMID:11811539 Park7 Rat Dibutyl phosphate affects expression ISO PARK7 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PARK7 mRNA CTD PMID:37042841 Park7 Rat dibutyl phthalate decreases expression ISO Park7 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PARK7 mRNA CTD PMID:21266533 Park7 Rat dicrotophos decreases expression ISO PARK7 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PARK7 mRNA CTD PMID:28302478 Park7 Rat Dienochlor decreases activity ISO PARK7 (Homo sapiens) 6480464 dienochlor results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat disodium selenite increases expression ISO PARK7 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PARK7 mRNA CTD PMID:18175754 Park7 Rat dithianon multiple interactions ISO PARK7 (Homo sapiens) 6480464 dithianone results in decreased activity of and results in increased oxidation of PARK7 protein CTD PMID:36842454 Park7 Rat diuron decreases expression ISO PARK7 (Homo sapiens) 6480464 Diuron results in decreased expression of PARK7 mRNA CTD PMID:35967413 Park7 Rat doxorubicin decreases response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in decreased susceptibility to Doxorubicin CTD PMID:24675091 Park7 Rat enzyme inhibitor multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PARK7 protein CTD PMID:23301498 Park7 Rat fenazaquin increases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 mutant form results in increased susceptibility to fenazaquin CTD PMID:21219333 Park7 Rat fenpyroximate decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to fenpyroximate CTD PMID:21219333 Park7 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PARK7 mRNA CTD PMID:18035473 Park7 Rat folic acid multiple interactions ISO Park7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PARK7 mRNA CTD PMID:22206623 Park7 Rat folpet decreases activity ISO PARK7 (Homo sapiens) 6480464 folpet results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat formetanate decreases activity ISO PARK7 (Homo sapiens) 6480464 formetanate results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat furfural multiple interactions ISO PARK7 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Park7 Rat gamma-hexachlorocyclohexane decreases activity ISO PARK7 (Homo sapiens) 6480464 Hexachlorocyclohexane results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat Garcinol multiple interactions ISO PARK7 (Homo sapiens) 6480464 garcinol inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of PARK7 protein] CTD PMID:36629037 Park7 Rat glutathione increases abundance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in increased abundance of Glutathione CTD PMID:18331584 Park7 Rat glyphosate increases expression ISO Park7 (Mus musculus) 6480464 Glyphosate results in increased expression of PARK7 protein CTD PMID:36173347 Park7 Rat haloperidol increases expression ISO Park7 (Mus musculus) 6480464 Haloperidol results in increased expression of PARK7 mRNA CTD PMID:14647396 Park7 Rat heparin increases expression EXP 6480464 Heparin results in increased expression of PARK7 protein CTD PMID:17488504 Park7 Rat hydralazine multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PARK7 mRNA CTD PMID:17183730 Park7 Rat hydrogen peroxide increases expression ISO PARK7 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PARK7 protein CTD PMID:11811539 Park7 Rat hydrogen peroxide affects metabolic processing ISO Park7 (Mus musculus) 6480464 PARK7 protein affects the metabolism of Hydrogen Peroxide CTD PMID:24936441 Park7 Rat hydrogen peroxide multiple interactions ISO Park7 (Mus musculus) 6480464 PRKN gene mutant form inhibits the reaction [Hydrogen Peroxide affects the localization of PARK7 protein] CTD PMID:22872702 Park7 Rat hydrogen peroxide affects localization ISO Park7 (Mus musculus) 6480464 Hydrogen Peroxide affects the localization of PARK7 protein CTD PMID:22872702 Park7 Rat hydrogen peroxide multiple interactions EXP 6480464 [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Hydrogen Peroxide CTD PMID:21372141 Park7 Rat hydrogen peroxide decreases response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:18377993 Park7 Rat inulin multiple interactions ISO Park7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PARK7 mRNA CTD PMID:36331819 Park7 Rat isoniazide affects expression ISO Park7 (Mus musculus) 6480464 Isoniazid affects the expression of PARK7 mRNA CTD PMID:24848797 Park7 Rat ivermectin decreases expression ISO PARK7 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PARK7 protein CTD PMID:32959892 Park7 Rat lactacystin decreases response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in decreased susceptibility to lactacystin CTD PMID:18331584 Park7 Rat lipopolysaccharide multiple interactions ISO Park7 (Mus musculus) 6480464 diphenyleneiodonium inhibits the reaction [Lipopolysaccharides results in increased expression of PARK7 protein] more ... CTD PMID:11811539 and PMID:26691871 Park7 Rat lipopolysaccharide increases expression ISO Park7 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PARK7 protein CTD PMID:11811539 Park7 Rat lipopolysaccharide affects localization ISO Park7 (Mus musculus) 6480464 Lipopolysaccharides affects the localization of PARK7 protein CTD PMID:19063952 Park7 Rat lutein multiple interactions ISO Park7 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of PARK7 mRNA CTD PMID:24865317 Park7 Rat LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [manganese chloride results in decreased expression of PARK7 protein] CTD PMID:22245093 Park7 Rat mancozeb multiple interactions ISO PARK7 (Homo sapiens) 6480464 mancozeb results in decreased activity of and results in increased oxidation of PARK7 protein CTD PMID:36842454 Park7 Rat maneb decreases activity ISO PARK7 (Homo sapiens) 6480464 Maneb results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat maneb multiple interactions ISO PARK7 (Homo sapiens) 6480464 3-(4-(morpholin-4-yl)-7H-pyrrolo(2 more ... CTD PMID:34897981 and PMID:36842454 Park7 Rat manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of PARK7 protein CTD PMID:20798247 Park7 Rat manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of PARK7 protein CTD PMID:20798247 Park7 Rat manganese(II) chloride multiple interactions EXP 6480464 15-deoxy-delta(12 more ... CTD PMID:22245093 Park7 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of PARK7 mRNA and manganese chloride results in decreased expression of PARK7 protein CTD PMID:20798247 and PMID:22245093 Park7 Rat meloxicam multiple interactions ISO PARK7 (Homo sapiens) 6480464 meloxicam inhibits the reaction [Paraquat promotes the reaction [Quinones binds to PARK7 protein]] CTD PMID:20851755 Park7 Rat mercury atom increases expression ISO PARK7 (Homo sapiens) 6480464 Mercury results in increased expression of PARK7 mRNA CTD PMID:16823088 Park7 Rat mercury atom affects binding ISO PARK7 (Homo sapiens) 6480464 Mercury binds to PARK7 protein CTD PMID:23792957 Park7 Rat mercury(0) increases expression ISO PARK7 (Homo sapiens) 6480464 Mercury results in increased expression of PARK7 mRNA CTD PMID:16823088 Park7 Rat mercury(0) affects binding ISO PARK7 (Homo sapiens) 6480464 Mercury binds to PARK7 protein CTD PMID:23792957 Park7 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PARK7 mRNA CTD PMID:28659758 Park7 Rat N-acetyl-L-cysteine multiple interactions ISO PARK7 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [3-(2-hydroxy-4-(1 more ... CTD PMID:18377993 more ... Park7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 PARK7 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPA1A protein] CTD PMID:18331584 Park7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO PARK7 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Paraquat results in increased sulfation of and results in increased oxidation of PARK7 protein] CTD PMID:26409479 Park7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in decreased susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde CTD PMID:18331584 Park7 Rat N-methyl-4-phenylpyridinium increases expression ISO Park7 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PARK7 mRNA CTD PMID:26558463 Park7 Rat N-methyl-4-phenylpyridinium multiple interactions ISO PARK7 (Homo sapiens) 6480464 garcinol inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of PARK7 protein] CTD PMID:36629037 Park7 Rat N-methyl-4-phenylpyridinium decreases expression ISO PARK7 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PARK7 protein CTD PMID:36629037 Park7 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of PARK7 protein CTD PMID:19716841 Park7 Rat nicotine multiple interactions ISO Park7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Park7 Rat nitrates multiple interactions ISO Park7 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PARK7 mRNA CTD PMID:35964746 Park7 Rat ouabain affects response to substance ISO Park7 (Mus musculus) 6480464 PARK7 affects the susceptibility to Ouabain CTD PMID:16624565 Park7 Rat oxamyl decreases activity ISO PARK7 (Homo sapiens) 6480464 oxamyl results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat oxidopamine multiple interactions EXP 6480464 [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Oxidopamine more ... CTD PMID:21372141 and PMID:25129099 Park7 Rat oxidopamine increases expression ISO PARK7 (Homo sapiens) 6480464 Oxidopamine results in increased expression of PARK7 mRNA and Oxidopamine results in increased expression of PARK7 protein CTD PMID:18377993 Park7 Rat oxidopamine affects localization ISO PARK7 (Homo sapiens) 6480464 Oxidopamine affects the localization of PARK7 protein CTD PMID:18377993 Park7 Rat oxidopamine multiple interactions ISO PARK7 (Homo sapiens) 6480464 Oxidopamine promotes the reaction [Quinones binds to PARK7 protein] CTD PMID:20851755 Park7 Rat oxidopamine decreases response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in decreased susceptibility to Oxidopamine CTD PMID:18377993 Park7 Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of PARK7 mRNA CTD PMID:25129099 Park7 Rat p-menthan-3-ol decreases expression ISO PARK7 (Homo sapiens) 6480464 Menthol results in decreased expression of PARK7 protein CTD PMID:26760959 Park7 Rat paracetamol affects expression ISO Park7 (Mus musculus) 6480464 Acetaminophen affects the expression of PARK7 mRNA CTD PMID:17562736 Park7 Rat paracetamol increases secretion ISO Park7 (Mus musculus) 6480464 Acetaminophen results in increased secretion of PARK7 protein CTD PMID:24038040 Park7 Rat paracetamol increases expression ISO PARK7 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PARK7 mRNA CTD PMID:25704631 Park7 Rat paraquat increases expression ISO PARK7 (Homo sapiens) 6480464 Paraquat results in increased expression of PARK7 protein and Paraquat results in increased expression of PARK7 protein alternative form CTD PMID:11697128 more ... Park7 Rat paraquat decreases expression ISO Park7 (Mus musculus) 6480464 Paraquat results in decreased expression of PARK7 mRNA CTD PMID:36108500 Park7 Rat paraquat decreases activity ISO PARK7 (Homo sapiens) 6480464 Paraquat results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat paraquat increases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in increased susceptibility to Paraquat CTD PMID:21300143 Park7 Rat paraquat multiple interactions ISO PARK7 (Homo sapiens) 6480464 3-(4-(morpholin-4-yl)-7H-pyrrolo(2 more ... CTD PMID:20851755 more ... Park7 Rat paraquat multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 gene mutant form affects the reaction [Paraquat affects the expression of NFE2L2 protein] more ... CTD PMID:17823202 and PMID:21300143 Park7 Rat perfluorododecanoic acid decreases expression EXP 6480464 perfluorododecanoic acid results in decreased expression of PARK7 protein CTD PMID:19854247 Park7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Park7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PARK7 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PARK7 mRNA CTD PMID:36331819 Park7 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PARK7 mRNA CTD PMID:28659758 Park7 Rat phlorizin increases expression ISO Park7 (Mus musculus) 6480464 Phlorhizin results in increased expression of PARK7 mRNA CTD PMID:22538082 Park7 Rat pirimiphos-methyl decreases activity ISO PARK7 (Homo sapiens) 6480464 pirimiphos methyl results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat potassium chromate increases expression ISO Park7 (Mus musculus) 6480464 potassium chromate(VI) results in increased expression of PARK7 protein CTD PMID:22144121 Park7 Rat propineb decreases activity ISO PARK7 (Homo sapiens) 6480464 propineb results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat prostaglandin E2 multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of Dinoprostone] and SB 203580 promotes the reaction [PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of Dinoprostone]] CTD PMID:26691871 Park7 Rat pyridaben decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to pyridaben CTD PMID:21219333 Park7 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PARK7 mRNA CTD PMID:28659758 Park7 Rat pyrimidifen increases expression ISO PARK7 (Homo sapiens) 6480464 pyrimidifen results in increased expression of PARK7 mRNA CTD PMID:33512557 Park7 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [aluminum lactate results in decreased expression of PARK7 protein] CTD PMID:26493151 Park7 Rat quercetin 3-O-beta-D-glucofuranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of PARK7 mRNA] CTD PMID:25129099 Park7 Rat quercetin 3-O-beta-D-glucopyranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of PARK7 mRNA] CTD PMID:25129099 Park7 Rat raloxifene increases expression ISO Park7 (Mus musculus) 6480464 Raloxifene Hydrochloride results in increased expression of PARK7 mRNA CTD PMID:33269387 Park7 Rat resmethrin decreases activity ISO PARK7 (Homo sapiens) 6480464 resmethrin results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat rotenone multiple interactions ISO PARK7 (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] more ... CTD PMID:16439141 more ... Park7 Rat rotenone multiple interactions EXP 6480464 Bibenzyls inhibits the reaction [Rotenone results in decreased expression of PARK7 protein] more ... CTD PMID:28245986 Park7 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PARK7 mRNA and Rotenone results in decreased expression of PARK7 protein CTD PMID:28245986 and PMID:32392329 Park7 Rat rotenone decreases expression ISO PARK7 (Homo sapiens) 6480464 Rotenone results in decreased expression of PARK7 protein CTD PMID:28245986 Park7 Rat rotenone increases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 mutant form results in increased susceptibility to Rotenone CTD PMID:21219333 Park7 Rat rotenone decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to Rotenone CTD PMID:22898350 Park7 Rat rotenone affects response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein affects the susceptibility to Rotenone CTD PMID:20940149 and PMID:26739068 Park7 Rat rotenone increases expression ISO PARK7 (Homo sapiens) 6480464 Rotenone results in increased expression of PARK7 mRNA and Rotenone results in increased expression of PARK7 protein CTD PMID:17459145 more ... Park7 Rat rotenone decreases response to substance ISO PARK7 (Homo sapiens) 6480464 PARK7 protein results in decreased susceptibility to Rotenone CTD PMID:18331584 more ... Park7 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of PARK7 protein CTD PMID:16439141 Park7 Rat rotenone increases expression ISO Park7 (Mus musculus) 6480464 Rotenone results in increased expression of PARK7 mRNA and Rotenone results in increased expression of PARK7 protein CTD PMID:17459145 and PMID:26806867 Park7 Rat rotenone affects localization EXP 6480464 Rotenone affects the localization of PARK7 protein CTD PMID:16439141 Park7 Rat rotenone affects localization ISO Park7 (Mus musculus) 6480464 Rotenone affects the localization of PARK7 protein CTD PMID:19063952 Park7 Rat rotenone decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to Rotenone CTD PMID:18930142 Park7 Rat rotenone affects response to substance ISO Park7 (Mus musculus) 6480464 PARK7 affects the susceptibility to Rotenone CTD PMID:16624565 Park7 Rat rotenone multiple interactions ISO Park7 (Mus musculus) 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:17459145 Park7 Rat rotenone affects localization ISO PARK7 (Homo sapiens) 6480464 Rotenone affects the localization of PARK7 protein CTD PMID:16439141 more ... Park7 Rat rutin multiple interactions EXP 6480464 Rutin inhibits the reaction [Oxidopamine results in increased expression of PARK7 mRNA] CTD PMID:25129099 Park7 Rat sarin decreases expression ISO PARK7 (Homo sapiens) 6480464 Sarin results in decreased expression of PARK7 mRNA CTD PMID:19522546 Park7 Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of PARK7 protein CTD PMID:28973502 Park7 Rat SB 203580 multiple interactions ISO Park7 (Mus musculus) 6480464 SB 203580 promotes the reaction [PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of Dinoprostone]] and SB 203580 promotes the reaction [PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]] CTD PMID:26691871 Park7 Rat silver atom increases expression ISO Park7 (Mus musculus) 6480464 Silver results in increased expression of PARK7 mRNA CTD PMID:19429238 Park7 Rat silver(0) increases expression ISO Park7 (Mus musculus) 6480464 Silver results in increased expression of PARK7 mRNA CTD PMID:19429238 Park7 Rat sodium arsenite decreases expression ISO PARK7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PARK7 mRNA CTD PMID:38568856 Park7 Rat sodium arsenite increases expression ISO PARK7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PARK7 mRNA CTD PMID:34032870 Park7 Rat sodium chloride multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PARK7 protein more ... CTD PMID:38598786 Park7 Rat superoxide multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 protein affects the reaction [Paraquat results in increased abundance of Superoxides] CTD PMID:21300143 Park7 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PARK7 protein CTD PMID:26141394 Park7 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PARK7 mRNA CTD PMID:31150632 Park7 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PARK7 protein CTD PMID:35544339 Park7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PARK7 mRNA CTD PMID:34492290 Park7 Rat thiram decreases expression ISO PARK7 (Homo sapiens) 6480464 Thiram results in decreased expression of PARK7 mRNA CTD PMID:38568856 Park7 Rat thiram decreases activity ISO PARK7 (Homo sapiens) 6480464 Thiram results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat toluene affects expression EXP 6480464 Toluene affects the expression of PARK7 mRNA CTD PMID:21827849 Park7 Rat trans-piceid multiple interactions ISO PARK7 (Homo sapiens) 6480464 [PRKN protein affects the susceptibility to polydatin] which results in increased expression of PARK7 protein and polydatin inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:31926197 Park7 Rat Tri-allate decreases activity ISO PARK7 (Homo sapiens) 6480464 Triallate results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat Tributyltin oxide decreases expression ISO Park7 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of PARK7 mRNA CTD PMID:22434021 Park7 Rat tungsten increases expression ISO Park7 (Mus musculus) 6480464 Tungsten results in increased expression of PARK7 mRNA CTD PMID:30912803 Park7 Rat valproic acid multiple interactions ISO PARK7 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PARK7 mRNA CTD PMID:17183730 Park7 Rat valproic acid affects expression ISO Park7 (Mus musculus) 6480464 Valproic Acid affects the expression of PARK7 mRNA CTD PMID:17292431 Park7 Rat valproic acid affects expression ISO PARK7 (Homo sapiens) 6480464 Valproic Acid affects the expression of PARK7 mRNA CTD PMID:25979313 Park7 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PARK7 mRNA CTD PMID:23034163 Park7 Rat vorinostat decreases expression ISO PARK7 (Homo sapiens) 6480464 vorinostat results in decreased expression of PARK7 protein CTD PMID:20543569 Park7 Rat zineb decreases activity ISO PARK7 (Homo sapiens) 6480464 Zineb results in decreased activity of PARK7 protein CTD PMID:36842454 Park7 Rat ziram decreases activity ISO PARK7 (Homo sapiens) 6480464 Ziram results in decreased activity of PARK7 protein CTD PMID:36842454
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (R,R,R)-alpha-tocopherol (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-bromopropane (EXP) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 15-deoxy-Delta(12,14)-prostaglandin J2 (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 3-chloropropane-1,2-diol (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-phenylbutyric acid (EXP,ISO) 6-propyl-2-thiouracil (EXP) amiodarone (ISO) ammonium chloride (EXP) amphetamine (ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenite(3-) (ISO) astemizole (EXP) benomyl (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bromobenzene (EXP) butyric acid (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) captan (ISO) CCCP (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium trinitrate (ISO) chromium(6+) (ISO) cisplatin (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) Cuprizon (EXP,ISO) DDE (ISO) dexamethasone (ISO) diazinon (EXP,ISO) dibenziodolium (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) Dienochlor (ISO) disodium selenite (ISO) dithianon (ISO) diuron (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) fenazaquin (ISO) fenpyroximate (ISO) flavonoids (EXP) folic acid (ISO) folpet (ISO) formetanate (ISO) furfural (ISO) gamma-hexachlorocyclohexane (ISO) Garcinol (ISO) glutathione (ISO) glyphosate (ISO) haloperidol (ISO) heparin (EXP) hydralazine (ISO) hydrogen peroxide (EXP,ISO) inulin (ISO) isoniazide (ISO) ivermectin (ISO) lactacystin (ISO) lipopolysaccharide (ISO) lutein (ISO) LY294002 (EXP) mancozeb (ISO) maneb (ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) meloxicam (ISO) mercury atom (ISO) mercury(0) (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosomorpholine (EXP) nicotine (ISO) nitrates (ISO) ouabain (ISO) oxamyl (ISO) oxidopamine (EXP,ISO) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (ISO) perfluorododecanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phlorizin (ISO) pirimiphos-methyl (ISO) potassium chromate (ISO) propineb (ISO) prostaglandin E2 (ISO) pyridaben (ISO) Pyridostigmine bromide (EXP) pyrimidifen (ISO) quercetin (EXP) quercetin 3-O-beta-D-glucofuranoside (EXP) quercetin 3-O-beta-D-glucopyranoside (EXP) raloxifene (ISO) resmethrin (ISO) rotenone (EXP,ISO) rutin (EXP) sarin (EXP,ISO) SB 203580 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (ISO) superoxide (ISO) T-2 toxin (EXP) tetrachloromethane (EXP) thapsigargin (EXP) thioacetamide (EXP) thiram (ISO) toluene (EXP) trans-piceid (ISO) Tri-allate (ISO) Tributyltin oxide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zineb (ISO) ziram (ISO)
Biological Process
adult locomotory behavior (ISO) androgen receptor signaling pathway (ISO,ISS) autophagy (IEA) cellular detoxification of aldehyde (ISO,ISS) cellular detoxification of methylglyoxal (ISO,ISS) cellular response to glyoxal (ISO,ISS) cellular response to hydrogen peroxide (ISO) cellular response to hypoxia (IEP) cellular response to lipopolysaccharide (IEP) cellular response to oxidative stress (ISO,ISS) cellular response to reactive oxygen species (ISO) detection of oxidative stress (ISO) detoxification of copper ion (ISO,ISS) detoxification of hydrogen peroxide (ISO,ISS) detoxification of mercury ion (ISO) DNA repair (ISO,ISS) dopamine uptake involved in synaptic transmission (ISO) fertilization (TAS) glucose homeostasis (ISO,ISS) glycolate biosynthetic process (IBA,ISO,ISS) glyoxal catabolic process (IEA) glyoxal metabolic process (IBA,ISO) guanine deglycation (ISO,ISS) guanine deglycation, glyoxal removal (ISO,ISS) guanine deglycation, methylglyoxal removal (ISO,ISS) hydrogen peroxide metabolic process (ISO) inflammatory response (IEA) insulin secretion (ISO,ISS) lactate biosynthetic process (ISO) maternal process involved in female pregnancy (IEP) membrane depolarization (ISO) membrane hyperpolarization (ISO) methylglyoxal catabolic process to lactate (ISO,ISS) methylglyoxal metabolic process (ISO,ISS) mitochondrion organization (ISO,ISS) negative regulation of cellular process (IMP) negative regulation of death-inducing signaling complex assembly (ISO) negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (ISO) negative regulation of extrinsic apoptotic signaling pathway (ISO,ISS) negative regulation of gene expression (ISO) negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway (ISO) negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide (ISO) negative regulation of neuron apoptotic process (ISO,ISS) negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway (ISO) negative regulation of NMDA glutamate receptor activity (IMP) negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (ISO) negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (ISO,ISS) negative regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO) negative regulation of protein catabolic process (ISO) negative regulation of protein export from nucleus (ISO,ISS) negative regulation of protein K48-linked deubiquitination (ISO,ISS) negative regulation of protein sumoylation (ISO,ISS) negative regulation of protein ubiquitination (ISO,ISS) negative regulation of reactive oxygen species biosynthetic process (ISO,ISS) negative regulation of smooth muscle cell migration (IDA) negative regulation of TRAIL-activated apoptotic signaling pathway (ISO,ISS) negative regulation of vascular associated smooth muscle cell proliferation (IDA) positive regulation of acute inflammatory response to antigenic stimulus (ISO,ISS) positive regulation of dopamine biosynthetic process (ISO,ISS) positive regulation of fertilization (IMP) positive regulation of gene expression (ISO) positive regulation of interleukin-8 production (ISO,ISS) positive regulation of L-dopa biosynthetic process (ISO,ISS) positive regulation of mitochondrial electron transport, NADH to ubiquinone (ISO,ISS) positive regulation of NAD(P)H oxidase activity (ISO,ISS) positive regulation of oxidative phosphorylation uncoupler activity (ISO,ISS) positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) positive regulation of protein localization to nucleus (ISO,ISS) positive regulation of protein-containing complex assembly (ISO,ISS) positive regulation of reactive oxygen species biosynthetic process (ISO) positive regulation of reactive oxygen species metabolic process (ISO,ISS) positive regulation of transcription by RNA polymerase II (ISO,ISS) protein repair (ISO) protein stabilization (ISO,ISS) proteolysis (IEA) regulation of androgen receptor signaling pathway (ISO,ISS) regulation of inflammatory response (ISO,ISS) regulation of mitochondrial membrane potential (ISO,ISS) regulation of neuron apoptotic process (ISO,ISS) regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (ISO) regulation of synaptic vesicle endocytosis (ISO) regulation of TRAIL production (ISO) removal of superoxide radicals (ISO,ISS) response to hydrogen peroxide (ISO) response to oxidative stress (IBA,IMP,ISO,ISS) response to xenobiotic stimulus (IEP) single fertilization (IEA) spermatogenesis (IEP) synaptic transmission, dopaminergic (ISO)
Cellular Component
axon (IDA) cell body (ISO) chromatin (ISO) cytoplasm (IBA,IEA,ISO,ISS) cytosol (ISO) endoplasmic reticulum (IDA,IEA,ISO) extracellular exosome (ISS) membrane (IEA) membrane raft (IEA) mitochondrial intermembrane space (ISO) mitochondrial matrix (ISO) mitochondrion (IBA,IDA,IEA,ISO,ISS) neuron projection (ISO) nucleoplasm (ISO) nucleus (IBA,IEA,ISO,ISS) perinuclear region of cytoplasm (ISO) plasma membrane (IEA) PML body (ISO,ISS) sperm head (IDA) synaptic vesicle (ISO)
Molecular Function
copper ion binding (ISO,ISS) cupric ion binding (ISO,ISS) cuprous ion binding (ISO,ISS) cytokine binding (ISO,ISS) DNA-binding transcription factor binding (ISO,ISS) double-stranded DNA binding (ISO) enzyme activator activity (ISO,ISS) enzyme binding (ISO) glyoxalase (glycolic acid-forming) activity (ISO,ISS) hydrolase activity (IEA) identical protein binding (ISO) kinase binding (ISO) L-dopa decarboxylase activator activity (ISO,ISS) mercury ion binding (ISO,ISS) mRNA binding (ISO,ISS) nuclear androgen receptor binding (ISO,ISS) oxidoreductase activity, acting on peroxide as acceptor (IBA,ISO) oxygen sensor activity (ISO) peptidase activity (IEA,ISO,ISS) peptidase inhibitor activity (ISO,ISS) peroxiredoxin activity (ISO) protein binding (IPI,ISO,ISS) protein deglycase activity (IEA,ISO,ISS) protein homodimerization activity (ISO,ISS) RNA binding (IEA) scaffold protein binding (ISO,ISS) signaling receptor activator activity (ISO) signaling receptor binding (ISO,ISS) single-stranded DNA binding (ISO) small protein activating enzyme binding (ISO,ISS) superoxide dismutase copper chaperone activity (ISO,ISS) transcription coactivator activity (ISO,ISS) tyrosine 3-monooxygenase activator activity (ISO,ISS) ubiquitin-like protein conjugating enzyme binding (ISO,ISS) ubiquitin-protein transferase inhibitor activity (ISO) ubiquitin-specific protease binding (ISO)
1.
The Parkinson's disease gene DJ-1 is also a key regulator of stroke-induced damage.
Aleyasin H, etal., Proc Natl Acad Sci U S A. 2007 Nov 20;104(47):18748-53. doi: 10.1073/pnas.0709379104. Epub 2007 Nov 14.
2.
Neuroprotective function of DJ-1 in Parkinson's disease.
Ariga H, etal., Oxid Med Cell Longev. 2013;2013:683920. doi: 10.1155/2013/683920. Epub 2013 May 16.
3.
The expression of DJ-1 (PARK7) in normal human CNS and idiopathic Parkinson's disease.
Bandopadhyay R, etal., Brain. 2004 Feb;127(Pt 2):420-30. Epub 2003 Dec 8.
4.
Localization of fertility factor SP22 to specific cell types within the anterior pituitary gland.
Benoit AM, etal., Exp Biol Med (Maywood). 2005 Nov;230(10):721-30.
5.
Expression of sperm protein 22 (SP22) in the rat ovary during different reproductive states.
Benoit AM, etal., Exp Biol Med (Maywood). 2007 Jul;232(7):910-20.
6.
Life-time expression of the proteins peroxiredoxin, beta-synuclein, PARK7/DJ-1, and stathmin in the primary visual and primary somatosensory cortices in rats.
Böhm MR, etal., Front Neuroanat. 2015 Mar 4;9:16. doi: 10.3389/fnana.2015.00016. eCollection 2015.
7.
Differential regulation of NMDA receptor function by DJ-1 and PINK1.
Chang N, etal., Aging Cell. 2010 Oct;9(5):837-50. doi: 10.1111/j.1474-9726.2010.00615.x.
8.
Phenotypic characterization of recessive gene knockout rat models of Parkinson's disease.
Dave KD, etal., Neurobiol Dis. 2014 Oct;70:190-203. doi: 10.1016/j.nbd.2014.06.009. Epub 2014 Jun 24.
9.
Up-regulation of caveolin-1 by DJ-1 attenuates rat pulmonary arterial hypertension by inhibiting TGFβ/Smad signaling pathway.
Gao W, etal., Exp Cell Res. 2017 Dec 1;361(1):192-198. doi: 10.1016/j.yexcr.2017.10.019. Epub 2017 Oct 22.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Protection against dopaminergic neurodegeneration in Parkinson's disease-model animals by a modulator of the oxidized form of DJ-1, a wild-type of familial Parkinson's disease-linked PARK7.
Inden M, etal., J Pharmacol Sci. 2011;117(3):189-203. Epub 2011 Oct 29.
12.
PARK7 DJ-1 protects against degeneration of nigral dopaminergic neurons in Parkinson's disease rat model.
Inden M, etal., Neurobiol Dis. 2006 Oct;24(1):144-58. Epub 2006 Jul 24.
13.
Identification of novel proteins associated with both alpha-synuclein and DJ-1.
Jin J, etal., Mol Cell Proteomics. 2007 May;6(5):845-59. Epub 2006 Jul 18.
14.
DJ-1 associates with lipid rafts by palmitoylation and regulates lipid rafts-dependent endocytosis in astrocytes.
Kim KS, etal., Hum Mol Genet. 2013 Dec 1;22(23):4805-17. doi: 10.1093/hmg/ddt332. Epub 2013 Jul 11.
15.
Localization of the sperm protein SP22 and inhibition of fertility in vivo and in vitro.
Klinefelter GR, etal., J Androl. 2002 Jan-Feb;23(1):48-63.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
L166P mutant DJ-1, causative for recessive Parkinson's disease, is degraded through the ubiquitin-proteasome system.
Miller DW, etal., J Biol Chem. 2003 Sep 19;278(38):36588-95. Epub 2003 Jul 8.
18.
DJ-1-binding compounds prevent oxidative stress-induced cell death and movement defect in Parkinson's disease model rats.
Miyazaki S, etal., J Neurochem. 2008 Jun 1;105(6):2418-34. doi: 10.1111/j.1471-4159.2008.05327.x.
19.
Rewiring of the Human Mitochondrial Interactome during Neuronal Reprogramming Reveals Regulators of the Respirasome and Neurogenesis.
Moutaoufik MT, etal., iScience. 2019 Sep 27;19:1114-1132. doi: 10.1016/j.isci.2019.08.057. Epub 2019 Sep 4.
20.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
22.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
23.
GOA pipeline
RGD automated data pipeline
24.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Comprehensive gene review and curation
RGD comprehensive gene curation
27.
Rotenone-induced parkinsonism elicits behavioral impairments and differential expression of parkin, heat shock proteins and caspases in the rat.
Sonia Angeline M, etal., Neuroscience. 2012 Sep 18;220:291-301. doi: 10.1016/j.neuroscience.2012.06.021. Epub 2012 Jun 16.
28.
Regulation of dopamine presynaptic markers and receptors in the striatum of DJ-1 and Pink1 knockout rats.
Sun J, etal., Neurosci Lett. 2013 Dec 17;557 Pt B:123-8. doi: 10.1016/j.neulet.2013.10.034. Epub 2013 Oct 22.
29.
Molecular cloning and expression of rat contraception associated protein 1 (CAP1), a protein putatively involved in fertilization.
Wagenfeld A, etal., Biochem Biophys Res Commun 1998 Oct 20;251(2):545-9.
30.
SP22: a novel fertility protein from a highly conserved gene family.
Welch JE, etal., J Androl 1998 Jul-Aug;19(4):385-93.
31.
Differential transport and local translation of cytoskeletal, injury-response, and neurodegeneration protein mRNAs in axons.
Willis D, etal., J Neurosci. 2005 Jan 26;25(4):778-91.
32.
Distribution of DJ-1, Parkinson's disease-related protein PARK7, and its alteration in 6-hydroxydopamine-treated hemiparkinsonian rat brain.
Yanagida T, etal., J Pharmacol Sci. 2006 Oct;102(2):243-7. Epub 2006 Oct 12.
33.
DJ-1 protects against neurodegeneration caused by focal cerebral ischemia and reperfusion in rats.
Yanagisawa D, etal., J Cereb Blood Flow Metab. 2008 Mar;28(3):563-78. doi: 10.1038/sj.jcbfm.9600553. Epub 2007 Sep 19.
34.
DJ-1 up-regulates glutathione synthesis during oxidative stress and inhibits A53T alpha-synuclein toxicity.
Zhou W and Freed CR, J Biol Chem. 2005 Dec 30;280(52):43150-8. Epub 2005 Oct 14.
35.
Daxx inhibits stress-induced apoptosis in cardiac myocytes.
Zobalova R, etal., Redox Rep. 2008;13(6):263-70. doi: 10.1179/135100008X308975.
Park7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,636,551 - 166,659,825 (-) NCBI GRCr8 mRatBN7.2 5 161,353,718 - 161,376,993 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,353,719 - 161,376,970 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,071,138 - 164,094,398 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,887,564 - 165,910,960 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,849,775 - 165,873,035 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 167,982,438 - 168,004,724 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 167,982,439 - 168,004,724 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,050,149 - 168,061,616 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 168,060,336 - 168,071,804 (-) NCBI Celera 5 159,607,648 - 159,630,713 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
PARK7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 7,961,711 - 7,985,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 7,954,291 - 7,985,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 8,021,771 - 8,045,565 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 7,944,380 - 7,967,926 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 7,956,058 - 7,979,602 NCBI Celera 1 7,128,771 - 7,152,398 (+) NCBI Celera Cytogenetic Map 1 p36.23 NCBI HuRef 1 7,169,316 - 7,193,163 (+) NCBI HuRef CHM1_1 1 8,009,469 - 8,033,097 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 7,492,675 - 7,516,444 (+) NCBI T2T-CHM13v2.0
Park7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 150,981,590 - 150,994,378 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 150,981,590 - 150,998,894 (-) Ensembl GRCm39 Ensembl GRCm38 4 150,897,133 - 150,909,921 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 150,897,133 - 150,914,437 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 150,271,242 - 150,284,030 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 149,740,942 - 149,753,650 (-) NCBI MGSCv36 mm8 Celera 4 153,174,297 - 153,187,100 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 81.52 NCBI
Park7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 4,969,497 - 4,985,885 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 4,974,130 - 4,985,927 (-) NCBI ChiLan1.0 ChiLan1.0
PARK7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 220,243,225 - 220,268,293 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 218,884,515 - 218,908,146 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 6,722,260 - 6,745,915 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 7,969,265 - 7,993,271 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 7,969,280 - 7,993,271 (+) Ensembl panpan1.1 panPan2
PARK7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 61,576,219 - 61,592,325 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 61,576,069 - 61,592,303 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 61,584,413 - 61,601,125 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 61,791,984 - 61,808,701 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 61,792,439 - 61,808,700 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 61,791,244 - 61,807,961 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 61,656,017 - 61,672,730 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 62,059,399 - 62,076,120 (+) NCBI UU_Cfam_GSD_1.0
Park7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 31,937,508 - 31,951,577 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936623 2,422,833 - 2,436,817 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936623 2,422,780 - 2,436,817 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PARK7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 68,629,214 - 68,645,516 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 68,629,327 - 68,645,147 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 63,023,779 - 63,033,855 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PARK7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 123,776,084 - 123,808,031 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 123,776,297 - 123,798,434 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 27,810,002 - 27,834,129 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Park7
.
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH142283
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 2 1059.6 UniSTS Cytogenetic Map 5 q36 UniSTS
This gene Park7 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024711 ⟹ ENSRNOP00000024711
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,360,664 - 161,376,970 (-) Ensembl Rnor_6.0 Ensembl 5 167,988,385 - 168,004,724 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087402 ⟹ ENSRNOP00000072068
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,360,666 - 161,372,093 (-) Ensembl Rnor_6.0 Ensembl 5 167,988,385 - 167,999,853 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091206 ⟹ ENSRNOP00000074942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,353,719 - 161,372,352 (-) Ensembl Rnor_6.0 Ensembl 5 167,982,439 - 168,000,083 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119817 ⟹ ENSRNOP00000085313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,360,728 - 161,372,339 (-) Ensembl
RefSeq Acc Id:
NM_001277249 ⟹ NP_001264178
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,636,551 - 166,655,184 (-) NCBI mRatBN7.2 5 161,353,718 - 161,372,352 (-) NCBI Rnor_6.0 5 167,982,438 - 168,000,083 (-) NCBI Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Celera 5 159,607,648 - 159,626,072 (-) NCBI
Sequence:
GCATGCGTGTTGTGTACAAATCTGTGCGACTGAGCCGGGTACGGTGTTCCTGCGGGACTGTCTGTGGCTTCGCGTGGGTGGAGGAGGCGCGGCTGCAGGTCTTTAAGAAATAGAAATGGCATCCAAAA
hide sequence
RefSeq Acc Id:
NM_001277250 ⟹ NP_001264179
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,643,486 - 166,655,184 (-) NCBI mRatBN7.2 5 161,360,654 - 161,372,352 (-) NCBI Rnor_6.0 5 167,988,385 - 168,000,083 (-) NCBI Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Celera 5 159,614,374 - 159,626,072 (-) NCBI
Sequence:
GCATGCGTGTTGTGTACAAATCTGTGCGACTGAGCCGGGTACGGTGTTCCTGCGGGACTGTCTG
hide sequence
RefSeq Acc Id:
NM_001277251 ⟹ NP_001264180
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,643,486 - 166,655,184 (-) NCBI mRatBN7.2 5 161,360,654 - 161,372,352 (-) NCBI Rnor_6.0 5 167,988,385 - 168,000,083 (-) NCBI Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Celera 5 159,614,374 - 159,626,072 (-) NCBI
Sequence:
GCATGCGTGTTGTGTACAAATCTGTGCGACTGAGCCGGGTACGGTGTTCCTGCGGGACTGTCTG
hide sequence
RefSeq Acc Id:
NM_001277252 ⟹ NP_001264181
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,643,486 - 166,655,184 (-) NCBI mRatBN7.2 5 161,360,654 - 161,372,352 (-) NCBI Rnor_6.0 5 167,988,385 - 168,000,083 (-) NCBI Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Celera 5 159,614,374 - 159,626,072 (-) NCBI
Sequence:
GCATGCGTGTTGTGTACAAATCTGTGCGACTGAGCCGGGTCTTTAAGAAATAGAAATGGCATCCAAAAGAGCTCTGGTCATCCTAGCCAAAGGAGCAGAGGAGATGGAGACAGTGATTCCTGTGGACA
hide sequence
RefSeq Acc Id:
NM_001277253 ⟹ NP_001264182
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,643,486 - 166,659,825 (-) NCBI mRatBN7.2 5 161,360,654 - 161,376,993 (-) NCBI Rnor_6.0 5 167,988,385 - 168,004,724 (-) NCBI Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Celera 5 159,614,374 - 159,630,713 (-) NCBI
Sequence:
TCATTTCCGGCGGGCGGTGCTCCGTGGGAGGCGTTCCGGGTGGTCAACCCTCGAGAAGCTTTAC
hide sequence
RefSeq Acc Id:
NM_057143 ⟹ NP_476484
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,643,486 - 166,654,954 (-) NCBI mRatBN7.2 5 161,360,654 - 161,372,122 (-) NCBI Rnor_6.0 5 167,988,385 - 167,999,853 (-) NCBI Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI RGSC_v3.4 5 168,050,149 - 168,061,616 (-) RGD Celera 5 159,614,374 - 159,625,842 (-) NCBI
Sequence:
GTGGCGAGCACAGTTACTGGAAGGCTTAACCAAAGTTTTGATGCCTGGGAACCGCGCAGGAAAAACACGCGGAACGTGCTTCACAGTGGCGGCTAACTGCTCTCGTTCGCGGTGCAGAGCCGTCTGGC
hide sequence
RefSeq Acc Id:
NP_476484 ⟸ NM_057143
- Peptide Label:
isoform 2
- UniProtKB:
O88767 (UniProtKB/Swiss-Prot), A6IUE4 (UniProtKB/TrEMBL), A0A8I6GCY6 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQGPYDVVVLPGGNLGAQNLSESALVKEILKEQENRKGLIAAICAGPTALLAHEVGFGCKVTSHPL
hide sequence
RefSeq Acc Id:
NP_001264178 ⟸ NM_001277249
- Peptide Label:
isoform 1
- UniProtKB:
Q5BKC3 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQ
hide sequence
RefSeq Acc Id:
NP_001264182 ⟸ NM_001277253
- Peptide Label:
isoform 2
- UniProtKB:
O88767 (UniProtKB/Swiss-Prot), A6IUE4 (UniProtKB/TrEMBL), A0A8I6GCY6 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQ
hide sequence
RefSeq Acc Id:
NP_001264181 ⟸ NM_001277252
- Peptide Label:
isoform 2
- UniProtKB:
O88767 (UniProtKB/Swiss-Prot), A6IUE4 (UniProtKB/TrEMBL), A0A8I6GCY6 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQGPYDVVVLPGGNLGAQNLSESALVKEILKEQENRKGLIAAICAGPTALLAHEVGFGCKVTSHPL
hide sequence
RefSeq Acc Id:
NP_001264179 ⟸ NM_001277250
- Peptide Label:
isoform 2
- UniProtKB:
O88767 (UniProtKB/Swiss-Prot), A6IUE4 (UniProtKB/TrEMBL), A0A8I6GCY6 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQ
hide sequence
RefSeq Acc Id:
NP_001264180 ⟸ NM_001277251
- Peptide Label:
isoform 2
- UniProtKB:
O88767 (UniProtKB/Swiss-Prot), A6IUE4 (UniProtKB/TrEMBL), A0A8I6GCY6 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQGPYDVVVLPGGNLGAQNLSESALVKEILKEQENRKGLIAAICAGPTALLAHEVGFGCKVTSHPL
hide sequence
Ensembl Acc Id:
ENSRNOP00000024711 ⟸ ENSRNOT00000024711
Ensembl Acc Id:
ENSRNOP00000072068 ⟸ ENSRNOT00000087402
Ensembl Acc Id:
ENSRNOP00000074942 ⟸ ENSRNOT00000091206
Ensembl Acc Id:
ENSRNOP00000085313 ⟸ ENSRNOT00000119817
RGD ID: 13694284 Promoter ID: EPDNEW_R4809 Type: initiation region Name: Park7_1 Description: Parkinsonism associated deglycase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R4810 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 168,000,070 - 168,000,130 EPDNEW
RGD ID: 13694285 Promoter ID: EPDNEW_R4810 Type: initiation region Name: Park7_2 Description: Parkinsonism associated deglycase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R4809 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 168,004,692 - 168,004,752 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Park7
parkinson protein 7
Park7
Parkinson disease (autosomal recessive, early onset) 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Park7
Parkinson disease (autosomal recessive, early onset) 7
fertility protein SP22
Name updated
1299863 APPROVED
2004-09-10
Park7
fertility protein SP22
SP22
Symbol and Name updated
1299863 APPROVED
2002-08-07
SP22
fertility protein SP22
Symbol and Name status set to provisional
70820 PROVISIONAL
