Advanced Search (OLGA)

Gene: Gtf3a (general transcription factor III A) Rattus norvegicus

Analyze

Symbol:

Gtf3a

Name:

general transcription factor III A

RGD ID:

619746

Description:

Enables DNA binding activity and RNA polymerase III general transcription initiation factor activity. Predicted to be involved in ribosomal large subunit biogenesis. Predicted to be active in nucleus. Orthologous to human GTF3A (general transcription factor IIIA); PARTICIPATES IN interleukin-4 signaling pathway; RNA polymerase III transcription pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

factor A; TFIIIA; transcription factor IIIA

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTF3A (general transcription factor IIIA)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Gtf3a (general transcription factor III A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtf3a (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GTF3A (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTF3A (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtf3a (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GTF3A (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTF3A (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtf3a (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gtf3a (general transcription factor IIIA)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GTF3A (general transcription factor IIIA)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gtf3a (general transcription factor III A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gtf3ab (general transcription factor IIIA, b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gtf3aa (general transcription factor IIIAa)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9609	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG9609	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gtf3a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtf3a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	13,250,643 - 13,258,587 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	13,250,644 - 13,258,587 (-)	Ensembl				GRCr8
mRatBN7.2	12	8,136,746 - 8,144,690 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	8,136,747 - 8,144,690 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	8,938,474 - 8,946,417 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	9,561,663 - 9,569,606 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	8,585,074 - 8,593,017 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	9,856,841 - 9,864,791 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	9,856,842 - 9,864,791 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	11,968,596 - 11,976,230 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	12	9,958,921 - 9,966,863 (-)	NCBI		Celera
Cytogenetic Map	12	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

human immunodeficiency virus infectious disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

DDE (ISO)

decabromodiphenyl ether (EXP)

dibutyl phthalate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

geraniol (ISO)

leflunomide (EXP)

nefazodone (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

thiram (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ribosomal large subunit biogenesis (IEA,ISO,ISS)

ribosome biogenesis (IEA)

transcription by RNA polymerase III (IEA)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA)

Molecular Function

5S rRNA binding (IEA,ISO,ISS)

DNA binding (IDA,IEA,ISO)

metal ion binding (IEA)

nucleic acid binding (IEA)

protein binding (IPI)

RNA binding (IEA)

RNA polymerase III general transcription initiation factor activity (IDA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

interleukin-4 signaling pathway (ISO)

RNA polymerase III transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	cDNA cloning, DNA binding, and evolution of mammalian transcription factor IIIA.	Hanas JS, etal., Gene 2002 Jan 9;282(1-2):43-52.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Identification of a transcription factor IIIA-interacting protein.	Moreland RJ, etal., Nucleic Acids Res. 2000 May 1;28(9):1986-93.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	A structural perspective on RNA polymerase I and RNA polymerase III transcription machineries.	Vannini A Biochim Biophys Acta. 2013 Mar-Apr;1829(3-4):258-64. doi: 10.1016/j.bbagrm.2012.09.009. Epub 2012 Sep 29.

Additional References at PubMed

PMID:8889548	PMID:24120868

Genomics

Comparative Map Data

Gtf3a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	13,250,643 - 13,258,587 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	13,250,644 - 13,258,587 (-)	Ensembl				GRCr8
mRatBN7.2	12	8,136,746 - 8,144,690 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	8,136,747 - 8,144,690 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	8,938,474 - 8,946,417 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	9,561,663 - 9,569,606 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	8,585,074 - 8,593,017 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	9,856,841 - 9,864,791 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	9,856,842 - 9,864,791 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	11,968,596 - 11,976,230 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	12	9,958,921 - 9,966,863 (-)	NCBI		Celera
Cytogenetic Map	12	p11	NCBI

GTF3A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	27,424,619 - 27,435,823 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	27,424,619 - 27,435,823 (+)	Ensembl			hg38	GRCh38
GRCh37	13	27,998,756 - 28,009,960 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	26,895,849 - 26,907,958 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	13	26,896,680 - 26,907,823	NCBI
Celera	13	9,067,358 - 9,078,526 (+)	NCBI		Celera
Cytogenetic Map	13	q12.2	NCBI
HuRef	13	8,820,040 - 8,831,212 (+)	NCBI		HuRef
CHM1_1	13	27,966,860 - 27,978,027 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	26,645,370 - 26,656,576 (+)	NCBI		T2T-CHM13v2.0

Gtf3a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	146,885,467 - 146,892,424 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	146,885,467 - 146,892,424 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	146,948,657 - 146,955,614 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	146,948,657 - 146,955,614 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	147,760,233 - 147,767,190 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	147,259,060 - 147,265,952 (+)	NCBI		MGSCv36	mm8
Celera	5	144,935,523 - 144,942,478 (+)	NCBI		Celera
Cytogenetic Map	5	G3	NCBI
cM Map	5	86.57	NCBI

Gtf3a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955497	6,842,960 - 6,851,835 (+)	Ensembl
ChiLan1.0	NW_004955497	6,836,568 - 6,852,177 (+)	NCBI	ChiLan1.0	ChiLan1.0

GTF3A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	27,020,179 - 27,031,300 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	18,124,906 - 18,136,034 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	8,713,701 - 8,724,829 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	27,059,129 - 27,070,098 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	27,059,069 - 27,070,100 (+)	Ensembl			panPan2	panpan1.1

GTF3A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	12,171,058 - 12,183,491 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	12,166,981 - 12,230,467 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	12,230,324 - 12,247,162 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	12,296,320 - 12,313,569 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	12,301,163 - 12,313,579 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	12,190,495 - 12,207,308 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	12,182,512 - 12,199,535 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	12,227,400 - 12,244,669 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gtf3a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	173,268,412 - 173,280,878 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	22,671,220 - 22,683,281 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	22,671,277 - 22,683,748 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTF3A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	4,857,023 - 4,869,272 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	11	4,853,305 - 4,869,297 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	4,333,205 - 4,346,164 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTF3A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	6,601,557 - 6,611,806 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	6,601,571 - 6,611,713 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666057	37,790,167 - 37,800,420 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtf3a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624776	11,071,065 - 11,079,663 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624776	11,070,662 - 11,079,870 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gtf3a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	6,923,909 - 6,931,168 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gtf3a
62 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	50
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000073026
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1357337	Gluco3	Glucose level QTL 3		0.0004	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	12	1	16966671	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	11869600	16966542	Rat
61334	Gluco17	Glucose level QTL 17	6.3		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	12	1	16966671	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
724526	Uae3	Urinary albumin excretion QTL 3	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	12	1	15486827	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

RH127547

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	13,250,726 - 13,251,110 (+)	Marker Load Pipeline
mRatBN7.2	2	185,201,535 - 185,201,724 (+)	MAPPER	mRatBN7.2
mRatBN7.2	12	8,136,829 - 8,137,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	9,856,925 - 9,857,308	NCBI	Rnor6.0
Rnor_6.0	2	199,776,213 - 199,776,401	NCBI	Rnor6.0
Rnor_5.0	12	11,968,680 - 11,969,063	UniSTS	Rnor5.0
Rnor_5.0	2	219,254,159 - 219,254,347	UniSTS	Rnor5.0
RGSC_v3.4	2	192,442,430 - 192,442,618	UniSTS	RGSC3.4
Celera	12	9,959,005 - 9,959,388	UniSTS
Celera	2	177,694,036 - 177,694,224	UniSTS
RH 3.4 Map	2	1255.3	UniSTS

BF390712

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	8,137,222 - 8,137,377 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	9,857,318 - 9,857,472	NCBI	Rnor6.0
Rnor_5.0	12	11,969,073 - 11,969,227	UniSTS	Rnor5.0
Celera	12	9,959,398 - 9,959,552	UniSTS
RH 3.4 Map	12	108.6	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	92	59	6	356	192	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001113570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF391798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB578423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB616240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK842762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073026 ⟹ ENSRNOP00000065623

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	13,250,644 - 13,258,587 (-)	Ensembl
mRatBN7.2 Ensembl	12	8,136,747 - 8,144,690 (-)	Ensembl
Rnor_6.0 Ensembl	12	9,856,842 - 9,864,791 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113731 ⟹ ENSRNOP00000092963

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	13,250,644 - 13,258,429 (-)	Ensembl
mRatBN7.2 Ensembl	12	8,136,747 - 8,144,532 (-)	Ensembl

RefSeq Acc Id:

NM_001113570 ⟹ NP_001107042

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	13,250,643 - 13,258,587 (-)	NCBI
mRatBN7.2	12	8,136,746 - 8,144,690 (-)	NCBI
Rnor_6.0	12	9,856,841 - 9,864,791 (-)	NCBI
Rnor_5.0	12	11,968,596 - 11,976,230 (-)	NCBI
Celera	12	9,958,921 - 9,966,863 (-)	RGD

Sequence:

show sequence

GCGCAATCCTGGCGCATGGGGTTTAATGGGCGGGACCTGGCGCCTTTGCGGGCCGCGTTCCCGG
AAGTGTCGGGTCTCTGGGCGCCGGTAGCTTGTGTCCCGCGTTCCGGGGACAGCACGTGGCTGCC
CCGCCTCGGCCCGGGCGCAGTTGCGTCGCCCTGGAGCCGCGGGTCTCGGTCGCGGAAGCGGTGT
CGTCCCTGACCATCGCGGACGCGTTCGTTCGGGCCTGTGTGGGCCCCGCCCCGCCGCGCCCCGC
GCTCCCCAGCAGGTTCATCTGCTCCTTTCCTGACTGCAGCGCTAGTTACAACAAAGCCTGGAAG
CTAGACGCGCACCTCTGCAAGCACACGGGGGAGAGGCCGTTCGTTTGTGACTATGAGGGCTGTG
GCAAAGCCTTCATCAGGGACTACCATCTGAGTCGACACATCCTGATTCACACCGGAGAAAAGCC
ATTTGTTTGTGCAGATAATGGCTGTAATCAGAAATTCAGCACAAAGTCAAACTTGAAGAAACAC
ATTGAACGCAAACATGAAAATCCACAAAAACAGTATGTGTGCAATTTTGAAGGTTGCAAGAAGG
CCTTTAAGAAGCACCAGCAGCTGAGAACCCATCAGTGCCAGCACACAAATGAGCCACTCTTCAG
GTGTACCCACGAGGGATGTGGGAAGCACTTTGCCTCCCCCAGCAGGCTGAAACGGCATGGGAAG
GTTCACGAGGGCTACCTATGTCAAAAGGGATGTTCCTTTGTGGGAAAAACGTGGACAGAGCTTC
TGAAGCACACGAGAGAAGCCCATAAAGAGGAGGTGACCTGCACAGTGTGCCAGAAGATGTTCAA
GCGCAAAGATCACCTTAAGCAGCACATGAAGACTCACGCTCCGGAGAGGGATGTGTACCGCTGC
CCGCGGGAAGGCTGTGCAAGGACCTACACCACCGTGTTCAACCTGCAGAGCCACATTCTCTCCT
TCCACGAGGAAAAGCGCCCATTTGTGTGTGAGCACGCTGGCTGTGGCAAGACGTTTGCAATGAA
ACAAAGTCTCATGAGGCACAGTGTCGTGCACGATCCTGACAAGAAGAGGATGAAGCTCAAAGTT
AGACCACCTCGGGAGAGACGCAGCTTGGCCTCGCGCCTCAGCGGGTACGTCCCTCCTAAGGGGA
AACAAGAGCCCGACTGCTCCTTGCCTAACAGCACAGAGTCCAGCAGCAGCCCAGAGGCCACGAT
GCTCGCCCCAGCTGCGTTACTTACTGTCCACTAGTTGGGAGGGACTTCAGAGCGGCTAGCAGAG
GCTTCTGGAGAAGCCCGGACTTCTCATTAAATCACTGACACAGGACGTCCGAAAAAAAAAAAAA
AAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001107042	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL69685	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065623
GenBank Protein	Q8VHT8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001107042 ⟸ NM_001113570

- UniProtKB:

Q8VHT8 (UniProtKB/Swiss-Prot), M0R833 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPRVSVAEAVSSLTIADAFVRACVGPAPPRPALPSRFICSFPDCSASYNKAWKLDAHLCKHTG
ERPFVCDYEGCGKAFIRDYHLSRHILIHTGEKPFVCADNGCNQKFSTKSNLKKHIERKHENPQK
QYVCNFEGCKKAFKKHQQLRTHQCQHTNEPLFRCTHEGCGKHFASPSRLKRHGKVHEGYLCQKG
CSFVGKTWTELLKHTREAHKEEVTCTVCQKMFKRKDHLKQHMKTHAPERDVYRCPREGCARTYT
TVFNLQSHILSFHEEKRPFVCEHAGCGKTFAMKQSLMRHSVVHDPDKKRMKLKVRPPRERRSLA
SRLSGYVPPKGKQEPDCSLPNSTESSSSPEATMLAPAALLTVH

hide sequence

Ensembl Acc Id:

ENSRNOP00000065623 ⟸ ENSRNOT00000073026

Ensembl Acc Id:

ENSRNOP00000092963 ⟸ ENSRNOT00000113731

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VHT8-F1-model_v2	AlphaFold	Q8VHT8	1-363	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698406

Promoter ID:

EPDNEW_R8931

Type:

initiation region

Name:

Gtf3a_1

Description:

general transcription factor III A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	9,864,716 - 9,864,776	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619746	AgrOrtholog
BioCyc Gene	G2FUF-20102	BioCyc
Ensembl Genes	ENSRNOG00000050016	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000073026	ENTREZGENE
Gene3D-CATH	Classic Zinc Finger	UniProtKB/Swiss-Prot
InterPro	TFIIIA_Zfn-C2H2	UniProtKB/Swiss-Prot
	Zinc_finger_trans_reg	UniProtKB/Swiss-Prot
	Znf_C2H2_sf	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	rno:246299	UniProtKB/Swiss-Prot
NCBI Gene	246299	ENTREZGENE
PANTHER	TRANSCRIPTION FACTOR IIIA	UniProtKB/Swiss-Prot
	ZINC FINGER PROTEIN	UniProtKB/Swiss-Prot
Pfam	TFIIIA_zf-C2H2	UniProtKB/Swiss-Prot
	zf-C2H2	UniProtKB/Swiss-Prot
PhenoGen	Gtf3a	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000050016	RatGTEx
SMART	ZnF_C2H2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57667	UniProtKB/Swiss-Prot
UniProt	A0A8I6AEW9_RAT	UniProtKB/TrEMBL
	M0R833	ENTREZGENE, UniProtKB/TrEMBL
	Q8VHT8	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Gtf3a	general transcription factor III A			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Gtf3a	general transcription factor III A			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains nine Cys(2)His(2) zinc fingers and a non-finger C-terminal tail	632850

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)