Symbol:
Ywhaq
Name:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta
RGD ID:
3979
Description:
Enables 14-3-3 protein binding activity and transmembrane transporter binding activity. Involved in negative regulation of monoatomic ion transmembrane transport. Part of protein-containing complex. Is active in synapse. Orthologous to human YWHAQ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; mTOR signaling pathway; phosphatidylinositol 3-kinase-Akt signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
14-3-3 protein tau; 14-3-3 protein theta; 14-3-3t; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 46,664,358 - 46,694,875 (-) NCBI GRCr8 mRatBN7.2 6 40,935,714 - 40,966,240 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 40,935,949 - 40,966,273 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 41,257,806 - 41,288,261 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 41,572,495 - 41,602,946 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 41,005,763 - 41,036,210 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 43,463,294 - 43,493,816 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 43,463,294 - 43,493,816 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 60,331,003 - 60,361,242 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 41,945,769 - 41,976,123 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 41,948,894 - 41,979,249 (-) NCBI Celera 6 40,222,774 - 40,252,668 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ywhaq Rat 1,2-dimethylhydrazine multiple interactions ISO Ywhaq (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of YWHAQ mRNA CTD PMID:22206623 Ywhaq Rat 17alpha-ethynylestradiol multiple interactions ISO Ywhaq (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of YWHAQ mRNA CTD PMID:17942748 Ywhaq Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of YWHAQ mRNA CTD PMID:17108234 Ywhaq Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ywhaq (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Ywhaq Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ywhaq (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of YWHAQ mRNA CTD PMID:17942748 Ywhaq Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of YWHAQ mRNA CTD PMID:34747641 Ywhaq Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ywhaq (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of YWHAQ mRNA CTD PMID:21570461 Ywhaq Rat 2,6-dimethoxyphenol multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of YWHAQ protein CTD PMID:38598786 Ywhaq Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of YWHAQ mRNA CTD PMID:21346803 Ywhaq Rat 3,3'-Dichlorobenzidine affects expression ISO YWHAQ (Homo sapiens) 6480464 3 and 3'-Dichlorobenzidine affects the expression of YWHAQ protein CTD PMID:24604609 Ywhaq Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of YWHAQ mRNA CTD PMID:19162173 Ywhaq Rat 4,4'-sulfonyldiphenol increases expression ISO YWHAQ (Homo sapiens) 6480464 bisphenol S results in increased expression of YWHAQ protein CTD PMID:34186270 Ywhaq Rat 4-hydroxyphenyl retinamide affects localization ISO YWHAQ (Homo sapiens) 6480464 Fenretinide affects the localization of YWHAQ protein CTD PMID:17110918 Ywhaq Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of YWHAQ mRNA CTD PMID:30047161 Ywhaq Rat acetylsalicylic acid increases expression ISO YWHAQ (Homo sapiens) 6480464 Aspirin results in increased expression of YWHAQ mRNA CTD PMID:15928584 Ywhaq Rat acrolein multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of YWHAQ mRNA CTD PMID:32845096 Ywhaq Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of YWHAQ mRNA CTD PMID:28959563 Ywhaq Rat AICA ribonucleotide multiple interactions ISO YWHAQ (Homo sapiens) 6480464 AICA ribonucleotide promotes the reaction [ABL1 protein mutant form binds to YWHAQ protein] and AICA ribonucleotide promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Ywhaq Rat aminoglutethimide increases expression ISO YWHAQ (Homo sapiens) 6480464 Aminoglutethimide results in increased expression of YWHAQ protein CTD PMID:26102013 Ywhaq Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of YWHAQ mRNA CTD PMID:30047161 Ywhaq Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of YWHAQ mRNA CTD PMID:16483693 Ywhaq Rat Aroclor 1254 decreases expression ISO Ywhaq (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of YWHAQ mRNA CTD PMID:23650126 Ywhaq Rat arsane increases ubiquitination ISO YWHAQ (Homo sapiens) 6480464 Arsenic results in increased ubiquitination of YWHAQ protein CTD PMID:35994080 Ywhaq Rat arsenic atom increases ubiquitination ISO YWHAQ (Homo sapiens) 6480464 Arsenic results in increased ubiquitination of YWHAQ protein CTD PMID:35994080 Ywhaq Rat arsenite(3-) multiple interactions ISO Ywhaq (Mus musculus) 6480464 [arsenite results in increased phosphorylation of ZFP36 protein] promotes the reaction [ZFP36 protein binds to YWHAQ protein] CTD PMID:15014438 Ywhaq Rat arsenous acid multiple interactions ISO YWHAQ (Homo sapiens) 6480464 Arsenic Trioxide promotes the reaction [ABL1 protein mutant form binds to YWHAQ protein] and Arsenic Trioxide promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Ywhaq Rat atrazine decreases expression ISO YWHAQ (Homo sapiens) 6480464 Atrazine results in decreased expression of YWHAQ mRNA CTD PMID:22378314 Ywhaq Rat benzatropine increases expression ISO YWHAQ (Homo sapiens) 6480464 Benztropine results in increased expression of YWHAQ protein CTD PMID:34122009 Ywhaq Rat benzene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of YWHAQ mRNA CTD PMID:17905399 Ywhaq Rat benzo[a]pyrene increases expression ISO Ywhaq (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of YWHAQ mRNA CTD PMID:22228805 Ywhaq Rat benzo[a]pyrene increases expression ISO YWHAQ (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of YWHAQ mRNA CTD PMID:33411230 Ywhaq Rat bis(2-ethylhexyl) phthalate increases expression ISO Ywhaq (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of YWHAQ mRNA CTD PMID:33754040 Ywhaq Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of YWHAQ mRNA CTD PMID:25181051 Ywhaq Rat bisphenol A decreases expression ISO Ywhaq (Mus musculus) 6480464 bisphenol A results in decreased expression of YWHAQ protein CTD PMID:35999755 Ywhaq Rat bisphenol A multiple interactions ISO Ywhaq (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of YWHAQ protein CTD PMID:35999755 Ywhaq Rat bisphenol A decreases expression ISO YWHAQ (Homo sapiens) 6480464 bisphenol A results in decreased expression of YWHAQ protein CTD PMID:34186270 Ywhaq Rat bisphenol A affects expression ISO YWHAQ (Homo sapiens) 6480464 bisphenol A affects the expression of YWHAQ mRNA CTD PMID:30903817 Ywhaq Rat bisphenol AF increases expression ISO YWHAQ (Homo sapiens) 6480464 bisphenol AF results in increased expression of YWHAQ protein CTD PMID:34186270 Ywhaq Rat Bisphenol B increases expression ISO YWHAQ (Homo sapiens) 6480464 bisphenol B results in increased expression of YWHAQ protein CTD PMID:34186270 Ywhaq Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of YWHAQ mRNA CTD PMID:15056800 Ywhaq Rat caffeine multiple interactions ISO YWHAQ (Homo sapiens) 6480464 Caffeine inhibits the reaction [CDC25C protein binds to YWHAQ protein] CTD PMID:11835680 Ywhaq Rat carbamazepine affects expression ISO YWHAQ (Homo sapiens) 6480464 Carbamazepine affects the expression of YWHAQ mRNA CTD PMID:24752500 Ywhaq Rat carbon nanotube multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Nanotubes and Carbon co-treated with calfactant] results in increased expression of YWHAQ protein CTD PMID:23026733 Ywhaq Rat CHIR 99021 multiple interactions ISO Ywhaq (Mus musculus) 6480464 Chir 99021 inhibits the reaction [1-Methyl-4-phenylpyridinium promotes the reaction [YWHAQ protein binds to TFEB protein]] CTD PMID:30165626 Ywhaq Rat chloropicrin decreases expression ISO YWHAQ (Homo sapiens) 6480464 chloropicrin results in decreased expression of YWHAQ mRNA CTD PMID:26352163 Ywhaq Rat chloroquine multiple interactions ISO YWHAQ (Homo sapiens) 6480464 Chloroquine promotes the reaction [ABL1 protein mutant form binds to YWHAQ protein] and Chloroquine promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Ywhaq Rat clozapine increases expression ISO YWHAQ (Homo sapiens) 6480464 Clozapine results in increased expression of YWHAQ protein CTD PMID:34122009 Ywhaq Rat copper atom multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of YWHAQ mRNA CTD PMID:30911355 Ywhaq Rat copper(0) multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of YWHAQ mRNA CTD PMID:30911355 Ywhaq Rat copper(II) sulfate decreases expression ISO YWHAQ (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of YWHAQ mRNA CTD PMID:19549813 Ywhaq Rat crocidolite asbestos decreases expression ISO Ywhaq (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of YWHAQ mRNA CTD PMID:29279043 Ywhaq Rat dextran sulfate multiple interactions ISO Ywhaq (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of YWHAQ protein CTD PMID:35999755 Ywhaq Rat diarsenic trioxide multiple interactions ISO YWHAQ (Homo sapiens) 6480464 Arsenic Trioxide promotes the reaction [ABL1 protein mutant form binds to YWHAQ protein] and Arsenic Trioxide promotes the reaction [XPO1 protein binds to YWHAQ protein] CTD PMID:33070465 Ywhaq Rat dibenzo[a,l]pyrene decreases expression ISO Ywhaq (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of YWHAQ mRNA CTD PMID:25908611 Ywhaq Rat dibutyl phthalate increases expression ISO Ywhaq (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of YWHAQ mRNA CTD PMID:21266533 Ywhaq Rat diclofenac affects expression ISO YWHAQ (Homo sapiens) 6480464 Diclofenac affects the expression of YWHAQ mRNA CTD PMID:24752500 Ywhaq Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of YWHAQ mRNA CTD PMID:16122865 Ywhaq Rat doxorubicin increases expression ISO YWHAQ (Homo sapiens) 6480464 Doxorubicin results in increased expression of YWHAQ mRNA CTD PMID:29803840 Ywhaq Rat enzyme inhibitor multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of YWHAQ protein CTD PMID:23301498 Ywhaq Rat ethanol increases expression ISO Ywhaq (Mus musculus) 6480464 Ethanol results in increased expression of YWHAQ mRNA CTD PMID:30319688 Ywhaq Rat ethanol affects splicing ISO Ywhaq (Mus musculus) 6480464 Ethanol affects the splicing of YWHAQ mRNA CTD PMID:30319688 Ywhaq Rat Evodiamine increases expression ISO YWHAQ (Homo sapiens) 6480464 evodiamine results in increased expression of YWHAQ mRNA CTD PMID:32057900 Ywhaq Rat fenthion decreases expression ISO Ywhaq (Mus musculus) 6480464 Fenthion results in decreased expression of YWHAQ mRNA CTD PMID:34813904 Ywhaq Rat folic acid multiple interactions ISO Ywhaq (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of YWHAQ mRNA CTD PMID:22206623 Ywhaq Rat FR900359 increases phosphorylation ISO YWHAQ (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of YWHAQ protein CTD PMID:37730182 Ywhaq Rat furan increases methylation EXP 6480464 furan results in increased methylation of YWHAQ gene CTD PMID:22079235 Ywhaq Rat furfural multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of YWHAQ protein CTD PMID:38598786 Ywhaq Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of YWHAQ mRNA CTD PMID:21782745 Ywhaq Rat genistein increases expression EXP 6480464 Genistein results in increased expression of YWHAQ mRNA CTD PMID:21782745 Ywhaq Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of YWHAQ mRNA CTD PMID:22061828 Ywhaq Rat glyphosate decreases expression ISO YWHAQ (Homo sapiens) 6480464 Glyphosate results in decreased expression of YWHAQ mRNA CTD PMID:31295307 Ywhaq Rat hydralazine multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of YWHAQ mRNA CTD PMID:17183730 Ywhaq Rat hydrogen peroxide affects expression ISO YWHAQ (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of YWHAQ mRNA CTD PMID:20044591 Ywhaq Rat indole-3-methanol decreases phosphorylation ISO YWHAQ (Homo sapiens) 6480464 indole-3-carbinol results in decreased phosphorylation of YWHAQ protein CTD PMID:29992829 Ywhaq Rat ivermectin decreases expression ISO YWHAQ (Homo sapiens) 6480464 Ivermectin results in decreased expression of YWHAQ protein CTD PMID:32959892 Ywhaq Rat lipopolysaccharide multiple interactions ISO Ywhaq (Mus musculus) 6480464 Lipopolysaccharides promotes the reaction [[ZFP36 protein binds to YWHAQ protein] which results in decreased degradation of TNF mRNA] and Lipopolysaccharides promotes the reaction [ZFP36 protein binds to YWHAQ protein] CTD PMID:15014438 Ywhaq Rat lithium atom decreases expression EXP 6480464 Lithium results in decreased expression of YWHAQ protein CTD PMID:18296634 Ywhaq Rat lithium hydride decreases expression EXP 6480464 Lithium results in decreased expression of YWHAQ protein CTD PMID:18296634 Ywhaq Rat mercury atom decreases expression ISO Ywhaq (Mus musculus) 6480464 Mercury analog results in decreased expression of YWHAQ mRNA CTD PMID:25056781 Ywhaq Rat mercury(0) decreases expression ISO Ywhaq (Mus musculus) 6480464 Mercury analog results in decreased expression of YWHAQ mRNA CTD PMID:25056781 Ywhaq Rat methidathion decreases expression ISO Ywhaq (Mus musculus) 6480464 methidathion results in decreased expression of YWHAQ mRNA CTD PMID:34813904 Ywhaq Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of YWHAQ mRNA CTD PMID:30047161 Ywhaq Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of YWHAQ mRNA CTD PMID:21782745 Ywhaq Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of YWHAQ mRNA CTD PMID:21782745 Ywhaq Rat methylmercury(1+) multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of YWHAQ mRNA CTD PMID:17905399 Ywhaq Rat Monobutylphthalate decreases expression ISO Ywhaq (Mus musculus) 6480464 monobutyl phthalate results in decreased expression of YWHAQ protein CTD PMID:20553848 Ywhaq Rat N-methyl-4-phenylpyridinium multiple interactions ISO Ywhaq (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium promotes the reaction [YWHAQ protein binds to TFEB protein] and Chir 99021 inhibits the reaction [1-Methyl-4-phenylpyridinium promotes the reaction [YWHAQ protein binds to TFEB protein]] CTD PMID:30165626 Ywhaq Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of YWHAQ mRNA CTD PMID:19638242 Ywhaq Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of YWHAQ mRNA CTD PMID:24136188 Ywhaq Rat nitrates multiple interactions ISO Ywhaq (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of YWHAQ mRNA CTD PMID:35964746 Ywhaq Rat nonanoic acid increases expression ISO Ywhaq (Mus musculus) 6480464 pelargonic acid results in increased expression of YWHAQ mRNA CTD PMID:11379042 Ywhaq Rat ozone multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of YWHAQ mRNA and [Air Pollutants results in increased abundance of Ozone] which affects the expression of YWHAQ mRNA CTD PMID:32845096 and PMID:35430440 Ywhaq Rat paclitaxel increases expression ISO YWHAQ (Homo sapiens) 6480464 Paclitaxel results in increased expression of YWHAQ protein CTD PMID:10822281 Ywhaq Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 Ywhaq Rat phenethyl isothiocyanate affects binding ISO YWHAQ (Homo sapiens) 6480464 YWHAQ protein binds to phenethyl isothiocyanate CTD PMID:21838287 Ywhaq Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of YWHAQ mRNA CTD PMID:19162173 Ywhaq Rat pirinixic acid decreases expression ISO Ywhaq (Mus musculus) 6480464 pirinixic acid results in decreased expression of YWHAQ mRNA CTD PMID:18445702 Ywhaq Rat pirinixic acid increases expression ISO Ywhaq (Mus musculus) 6480464 pirinixic acid results in increased expression of YWHAQ mRNA CTD PMID:23811191 Ywhaq Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of YWHAQ mRNA CTD PMID:19162173 Ywhaq Rat poly(propylene imine) macromolecule decreases expression ISO YWHAQ (Homo sapiens) 6480464 poly(propyleneimine) analog results in decreased expression of YWHAQ mRNA CTD PMID:16308212 Ywhaq Rat quercetin decreases expression ISO YWHAQ (Homo sapiens) 6480464 Quercetin results in decreased expression of YWHAQ mRNA CTD PMID:23727915 Ywhaq Rat resveratrol increases expression ISO YWHAQ (Homo sapiens) 6480464 resveratrol results in increased expression of YWHAQ protein CTD PMID:25533949 Ywhaq Rat SB 431542 multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of YWHAQ protein CTD PMID:37664457 Ywhaq Rat silicon dioxide affects secretion ISO YWHAQ (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of YWHAQ protein CTD PMID:25895662 Ywhaq Rat sodium arsenite multiple interactions ISO YWHAQ (Homo sapiens) 6480464 sodium arsenite inhibits the reaction [LRRK2 protein binds to YWHAQ protein] CTD PMID:24942733 Ywhaq Rat sodium chloride multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of YWHAQ protein more ... CTD PMID:38598786 Ywhaq Rat sodium fluoride increases expression ISO Ywhaq (Mus musculus) 6480464 Sodium Fluoride results in increased expression of YWHAQ protein CTD PMID:27548804 Ywhaq Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of YWHAQ mRNA CTD PMID:30047161 Ywhaq Rat sulforaphane affects binding ISO YWHAQ (Homo sapiens) 6480464 YWHAQ protein binds to sulforaphane CTD PMID:21838287 Ywhaq Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of YWHAQ protein CTD PMID:26141394 Ywhaq Rat Thiotepa increases expression ISO YWHAQ (Homo sapiens) 6480464 Thiotepa results in increased expression of YWHAQ protein CTD PMID:10822281 Ywhaq Rat titanium dioxide decreases methylation ISO Ywhaq (Mus musculus) 6480464 titanium dioxide results in decreased methylation of YWHAQ promoter CTD PMID:35295148 Ywhaq Rat toluene 2,4-diisocyanate increases expression ISO Ywhaq (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of YWHAQ mRNA CTD PMID:11379042 Ywhaq Rat trichloroethene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of YWHAQ mRNA CTD PMID:17905399 Ywhaq Rat triphenyl phosphate affects expression ISO YWHAQ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of YWHAQ mRNA CTD PMID:37042841 Ywhaq Rat triphenylstannane decreases expression ISO YWHAQ (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of YWHAQ protein CTD PMID:31634547 Ywhaq Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of YWHAQ mRNA CTD PMID:23639586 Ywhaq Rat uranium atom affects expression ISO YWHAQ (Homo sapiens) 6480464 Uranium affects the expression of YWHAQ mRNA CTD PMID:15672453 Ywhaq Rat valproic acid multiple interactions ISO YWHAQ (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of YWHAQ mRNA CTD PMID:17183730 Ywhaq Rat valproic acid decreases methylation ISO YWHAQ (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of YWHAQ gene CTD PMID:29154799 Ywhaq Rat vincaleukoblastine affects response to substance ISO YWHAQ (Homo sapiens) 6480464 YWHAQ protein affects the susceptibility to Vinblastine CTD PMID:16217747 Ywhaq Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of YWHAQ gene CTD PMID:31682807
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,3'-Dichlorobenzidine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (EXP) AICA ribonucleotide (ISO) aminoglutethimide (ISO) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzatropine (ISO) benzene (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bromobenzene (EXP) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) CHIR 99021 (ISO) chloropicrin (ISO) chloroquine (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dimethylarsinic acid (EXP) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) Evodiamine (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) furfural (ISO) genistein (EXP) gentamycin (EXP) glyphosate (ISO) hydralazine (ISO) hydrogen peroxide (ISO) indole-3-methanol (ISO) ivermectin (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) mercury atom (ISO) mercury(0) (ISO) methidathion (ISO) methimazole (EXP) methoxychlor (EXP) methylmercury(1+) (EXP) Monobutylphthalate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nitrates (ISO) nonanoic acid (ISO) ozone (ISO) paclitaxel (ISO) PCB138 (EXP) phenethyl isothiocyanate (ISO) phenobarbital (EXP) pirinixic acid (EXP,ISO) poly(propylene imine) macromolecule (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) T-2 toxin (EXP) Thiotepa (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triphenylstannane (ISO) Triptolide (EXP) uranium atom (ISO) valproic acid (ISO) vincaleukoblastine (ISO) vinclozolin (EXP)
1.
14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation.
Choi SJ, etal., Nucleic Acids Res. 2001 Jul 1;29(13):2836-42.
2.
Edaravone protects cortical neurons from apoptosis by inhibiting the translocation of BAX and Increasing the interaction between 14-3-3 and p-BAD.
Fan J, etal., Int J Neurosci. 2012 Nov;122(11):665-74. doi: 10.3109/00207454.2012.707714. Epub 2012 Aug 21.
3.
Ceramide recruits and activates protein kinase C zeta (PKC zeta) within structured membrane microdomains.
Fox TE, etal., J Biol Chem. 2007 Apr 27;282(17):12450-7. Epub 2007 Feb 17.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
14-3-3theta is a binding partner of rat Eag1 potassium channels.
Hsu PH, etal., PLoS One. 2012;7(7):e41203. doi: 10.1371/journal.pone.0041203. Epub 2012 Jul 20.
7.
Characterization of the antiapoptotic Bcl-2 family member myeloid cell leukemia-1 (Mcl-1) and the stimulation of its message by gonadotropins in the rat ovary.
Leo CP, etal., Endocrinology 1999 Dec;140(12):5469-77.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Isoform- and subcellular fraction-specific differences in hippocampal 14-3-3 levels following experimentally evoked seizures and in human temporal lobe epilepsy.
Schindler CK, etal., J Neurochem. 2006 Oct;99(2):561-9. Epub 2006 Sep 18.
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.
Molecular cloning of rat cDNAs for the zeta and theta subtypes of 14-3-3 protein and differential distributions of their mRNAs in the brain.
Watanabe M, etal., Brain Res Mol Brain Res 1994 Aug;25(1-2):113-21.
18.
Increased expression of a proline-rich Akt substrate (PRAS40) in human copper/zinc-superoxide dismutase transgenic rats protects motor neurons from death after spinal cord injury.
Yu F, etal., J Cereb Blood Flow Metab. 2008 Jan;28(1):44-52. Epub 2007 Apr 25.
Ywhaq Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 46,664,358 - 46,694,875 (-) NCBI GRCr8 mRatBN7.2 6 40,935,714 - 40,966,240 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 40,935,949 - 40,966,273 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 41,257,806 - 41,288,261 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 41,572,495 - 41,602,946 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 41,005,763 - 41,036,210 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 43,463,294 - 43,493,816 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 43,463,294 - 43,493,816 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 60,331,003 - 60,361,242 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 41,945,769 - 41,976,123 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 41,948,894 - 41,979,249 (-) NCBI Celera 6 40,222,774 - 40,252,668 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
YWHAQ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 9,583,967 - 9,630,997 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 9,583,967 - 9,630,997 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 9,724,096 - 9,771,126 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 9,641,557 - 9,688,557 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 9,674,703 - 9,721,704 NCBI Celera 2 9,635,980 - 9,682,954 (-) NCBI Celera Cytogenetic Map 2 p25.1 NCBI HuRef 2 9,569,609 - 9,616,664 (-) NCBI HuRef CHM1_1 2 9,653,476 - 9,700,564 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 9,609,000 - 9,656,011 (-) NCBI T2T-CHM13v2.0
Ywhaq Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 21,440,330 - 21,467,437 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 21,440,072 - 21,467,638 (-) Ensembl GRCm39 Ensembl GRCm38 12 21,390,329 - 21,417,436 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 21,390,071 - 21,417,637 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 21,396,190 - 21,423,297 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 21,636,819 - 21,663,926 (-) NCBI MGSCv36 mm8 Celera 12 19,483,848 - 19,511,370 (+) NCBI Celera Cytogenetic Map 12 A1.3 NCBI cM Map 12 8.31 NCBI
Ywhaq Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955487 5,230,506 - 5,263,752 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955487 5,229,485 - 5,263,749 (-) NCBI ChiLan1.0 ChiLan1.0
YWHAQ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 116,895,271 - 116,943,104 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 116,899,244 - 116,946,787 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 9,573,413 - 9,620,495 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 9,735,448 - 9,772,074 (-) NCBI panpan1.1 PanPan1.1 panPan2
YWHAQ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 6,660,504 - 6,697,954 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 6,588,178 - 6,625,624 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 6,759,032 - 6,796,562 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 6,758,751 - 6,796,522 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 6,651,427 - 6,688,863 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 6,653,706 - 6,691,132 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 6,667,564 - 6,705,013 (-) NCBI UU_Cfam_GSD_1.0
Ywhaq
YWHAQ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 126,738,862 - 126,772,778 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 126,738,795 - 126,772,784 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 135,245,481 - 135,278,697 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
YWHAQ
Ywhaq
.
Predicted Target Of
Count of predictions: 532 Count of miRNA genes: 270 Interacting mature miRNAs: 334 Transcripts: ENSRNOT00000011501 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 8693632 Alc27 Alcohol consumption QTL 27 2.2 0.791 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 34323357 51121479 Rat 634318 Bw118 Body weight QTL 118 3.55 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 6 33309549 57730294 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70199 Coreg1 Compensatory renal growth QTL 1 11.8 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 6 35691618 57730540 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat
RH143719
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 40,959,183 - 40,959,320 (+) MAPPER mRatBN7.2 Rnor_6.0 6 43,486,758 - 43,486,894 NCBI Rnor6.0 Rnor_5.0 6 60,354,186 - 60,354,322 UniSTS Rnor5.0 RGSC_v3.4 6 41,969,065 - 41,969,201 UniSTS RGSC3.4 Celera 6 40,245,612 - 40,245,748 UniSTS RH 3.4 Map 6 236.6 UniSTS Cytogenetic Map 6 q16 UniSTS
Ywhaq
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 78,556,250 - 78,556,859 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,229,061 - 79,229,669 NCBI Rnor6.0 Rnor_5.0 4 143,910,762 - 143,911,370 UniSTS Rnor5.0 Celera 4 73,476,716 - 73,477,324 UniSTS Cytogenetic Map 6 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000077786 ⟹ ENSRNOP00000072011
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 40,936,003 - 40,965,826 (-) Ensembl Rnor_6.0 Ensembl 6 43,463,294 - 43,493,816 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115392 ⟹ ENSRNOP00000077932
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 40,935,949 - 40,966,273 (-) Ensembl
RefSeq Acc Id:
NM_013053 ⟹ NP_037185
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 46,664,358 - 46,694,875 (-) NCBI mRatBN7.2 6 40,935,714 - 40,966,240 (-) NCBI Rnor_6.0 6 43,463,294 - 43,493,816 (-) NCBI Rnor_5.0 6 60,331,003 - 60,361,242 (-) NCBI RGSC_v3.4 6 41,945,769 - 41,976,123 (-) RGD Celera 6 40,222,774 - 40,252,668 (-) RGD
Sequence:
AGATCAAAGTGGTGGGACTCGCGTCGCGGCCGCGGAGACTAGAAGGAGGACTCCGGATCCGGCTCGGCGCTCGCCCTCGCTCGCCATGGAGAAGACCGAGCTGATCCAGAAGGCCAAGCTGGCCGAGC
hide sequence
RefSeq Acc Id:
NP_037185 ⟸ NM_013053
- UniProtKB:
P68255 (UniProtKB/Swiss-Prot), A6HAW8 (UniProtKB/TrEMBL), A0A8L2R4Y2 (UniProtKB/TrEMBL)
- Sequence:
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRY
hide sequence
Ensembl Acc Id:
ENSRNOP00000072011 ⟸ ENSRNOT00000077786
Ensembl Acc Id:
ENSRNOP00000077932 ⟸ ENSRNOT00000115392
RGD ID: 13694518 Promoter ID: EPDNEW_R5041 Type: initiation region Name: Ywhaq_2 Description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activationprotein, theta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5042 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 43,493,371 - 43,493,431 EPDNEW
RGD ID: 13694519 Promoter ID: EPDNEW_R5042 Type: initiation region Name: Ywhaq_1 Description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activationprotein, theta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5041 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 43,493,803 - 43,493,863 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-12-11
Ywhaq
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta
Ywhaq
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Ywhaq
Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
highly expressed in cerebellar cortex and the hippocampus
727985
gene_protein
245 amino acids
727985
