Symbol:
Tph1
Name:
tryptophan hydroxylase 1
RGD ID:
3895
Description:
Enables tryptophan 5-monooxygenase activity. Involved in circadian rhythm; negative regulation of ossification; and response to immobilization stress. Predicted to be located in cytoplasm. Predicted to be active in neuron projection. Biomarker of depressive disorder. Human ortholog(s) of this gene implicated in several diseases, including alcohol use disorder; attention deficit hyperactivity disorder; borderline personality disorder; depressive disorder (multiple); and heroin dependence. Orthologous to human TPH1 (tryptophan hydroxylase 1); PARTICIPATES IN tryptophan metabolic pathway; INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 4,4'-sulfonyldiphenol; 5-hydroxytryptophan.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Tph; tryptophan 5-hydroxylase 1; tryptophan 5-monooxygenase 1; tryptophan hydroxylase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TPH1 (tryptophan hydroxylase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tph1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tph1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TPH1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TPH1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tph1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TPH1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TPH1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tph1 (tryptophan hydroxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TPH1 (tryptophan hydroxylase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tph1 (tryptophan hydroxylase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tph1b (tryptophan hydroxylase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tph-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tph1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Trhn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Tph1em1Mcwi
Tph1em3Mcwi
Tph1em4Mcwi
Genetic Models:
WKY-Tph1em1Mcwi
DA-Tph1em4Mcwi
WKY-Tph1em3Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 106,293,695 - 106,314,628 (-) NCBI GRCr8 mRatBN7.2 1 97,157,375 - 97,178,415 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 97,157,409 - 97,178,344 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 102,543,405 - 102,564,448 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 111,015,397 - 111,036,438 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 104,305,773 - 104,326,712 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 102,669,868 - 102,699,442 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 102,669,868 - 102,699,442 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 103,746,878 - 103,774,100 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 97,186,071 - 97,207,551 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 97,264,181 - 97,285,662 (-) NCBI Celera 1 91,404,769 - 91,425,505 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tph1 Rat 1,2-dibromoethane increases expression ISO Tph1 (Mus musculus) 6480464 Ethylene Dibromide results in increased expression of TPH1 mRNA CTD PMID:15612046 Tph1 Rat 1,2-dimethylhydrazine decreases expression ISO Tph1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TPH1 mRNA CTD PMID:22206623 Tph1 Rat 1,3,5-trinitro-1,3,5-triazinane decreases expression EXP 6480464 cyclonite results in decreased expression of TPH1 mRNA CTD PMID:25559034 Tph1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tph1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to TPH1 gene] CTD PMID:20819909 Tph1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tph1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TPH1 mRNA CTD PMID:21354282 Tph1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tph1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TPH1 mRNA CTD PMID:20819909 Tph1 Rat 2-nitrotoluene increases expression ISO Tph1 (Mus musculus) 6480464 2-nitrotoluene results in increased expression of TPH1 mRNA CTD PMID:15612046 Tph1 Rat 3-Amino-1-methyl-5H-pyrido[4,3-b]indole decreases activity ISO Tph1 (Mus musculus) 6480464 3-amino-1-methyl-5H-pyrido(4 and 3-b)indole results in decreased activity of TPH1 protein CTD PMID:1989631 Tph1 Rat 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of TPH1 mRNA CTD PMID:26186136 Tph1 Rat 4,4'-sulfonyldiphenol increases expression ISO Tph1 (Mus musculus) 6480464 bisphenol S results in increased expression of TPH1 mRNA CTD PMID:30951980 Tph1 Rat 5-hydroxytryptophan multiple interactions EXP 6480464 [TPH1 protein results in increased hydroxylation of Tryptophan] which results in increased chemical synthesis of 5-Hydroxytryptophan CTD PMID:32243540 Tph1 Rat 5-methoxytryptamine decreases expression EXP 6480464 5-Methoxytryptamine results in decreased expression of TPH1 mRNA CTD PMID:32243540 Tph1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TPH1 mRNA CTD PMID:28959563 Tph1 Rat aflatoxin B1 increases methylation ISO TPH1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TPH1 gene CTD PMID:27153756 Tph1 Rat aldehydo-D-glucose multiple interactions ISO TPH1 (Homo sapiens) 6480464 TPH1 protein affects the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:30562058 Tph1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TPH1 mRNA CTD PMID:35163327 Tph1 Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of TPH1 protein CTD PMID:16483693 Tph1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TPH1 mRNA CTD PMID:16483693 Tph1 Rat arsane multiple interactions EXP 6480464 [Curcumin co-treated with Chitosan analog] inhibits the reaction [Arsenic results in decreased expression of TPH1 protein] CTD PMID:22704994 Tph1 Rat arsenic atom multiple interactions EXP 6480464 [Curcumin co-treated with Chitosan analog] inhibits the reaction [Arsenic results in decreased expression of TPH1 protein] CTD PMID:22704994 Tph1 Rat arsenous acid multiple interactions ISO Tph1 (Mus musculus) 6480464 Taurine inhibits the reaction [Arsenic Trioxide results in decreased expression of TPH1 mRNA] CTD PMID:23392890 Tph1 Rat arsenous acid decreases expression ISO Tph1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TPH1 mRNA CTD PMID:23392890 and PMID:23518225 Tph1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TPH1 mRNA CTD PMID:36841081 Tph1 Rat benzo[a]pyrene increases expression ISO TPH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TPH1 mRNA CTD PMID:22316170 Tph1 Rat benzo[a]pyrene increases methylation ISO TPH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TPH1 promoter CTD PMID:27901495 Tph1 Rat bis(2-chloroethyl) sulfide increases expression ISO Tph1 (Mus musculus) 6480464 Mustard Gas results in increased expression of TPH1 mRNA CTD PMID:15674843 Tph1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TPH1 mRNA CTD PMID:25181051 more ... Tph1 Rat bisphenol A decreases expression ISO Tph1 (Mus musculus) 6480464 bisphenol A results in decreased expression of TPH1 mRNA CTD PMID:34082316 Tph1 Rat bisphenol A increases expression ISO Tph1 (Mus musculus) 6480464 bisphenol A results in increased expression of TPH1 mRNA CTD PMID:30951980 Tph1 Rat bisphenol F decreases expression EXP 6480464 4 and 4'-bisphenol F results in decreased expression of TPH1 mRNA CTD PMID:26186136 Tph1 Rat bisphenol F decreases expression ISO Tph1 (Mus musculus) 6480464 bisphenol F results in decreased expression of TPH1 protein CTD PMID:38266696 Tph1 Rat bisphenol F increases expression ISO Tph1 (Mus musculus) 6480464 bisphenol F results in increased expression of TPH1 mRNA CTD PMID:30951980 Tph1 Rat cadmium dichloride increases expression ISO TPH1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TPH1 mRNA CTD PMID:38568856 Tph1 Rat carbidopa multiple interactions ISO Tph1 (Mus musculus) 6480464 [sarpogrelate co-treated with Carbidopa] inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 mRNA] and [sarpogrelate co-treated with Carbidopa] inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 protein] CTD PMID:35202708 Tph1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of TPH1 mRNA CTD PMID:18500788 Tph1 Rat chitosan multiple interactions EXP 6480464 [Curcumin co-treated with Chitosan analog] inhibits the reaction [Arsenic results in decreased expression of TPH1 protein] CTD PMID:22704994 Tph1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of TPH1 mRNA CTD PMID:17452286 and PMID:18835401 Tph1 Rat cisplatin multiple interactions ISO Tph1 (Mus musculus) 6480464 sarpogrelate inhibits the reaction [Cisplatin results in increased expression of TPH1 protein] CTD PMID:34560070 Tph1 Rat cisplatin increases expression ISO Tph1 (Mus musculus) 6480464 Cisplatin results in increased expression of TPH1 protein CTD PMID:34560070 Tph1 Rat cisplatin multiple interactions ISO TPH1 (Homo sapiens) 6480464 sarpogrelate inhibits the reaction [Cisplatin results in increased expression of TPH1 protein] CTD PMID:34560070 Tph1 Rat cisplatin increases expression ISO TPH1 (Homo sapiens) 6480464 Cisplatin results in increased expression of TPH1 mRNA and Cisplatin results in increased expression of TPH1 protein CTD PMID:34560070 Tph1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of TPH1 mRNA CTD PMID:21318169 Tph1 Rat curcumin multiple interactions EXP 6480464 [Curcumin co-treated with Chitosan analog] inhibits the reaction [Arsenic results in decreased expression of TPH1 protein] CTD PMID:22704994 Tph1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of TPH1 mRNA and cypermethrin results in decreased expression of TPH1 protein CTD PMID:26115703 Tph1 Rat D-glucose multiple interactions ISO TPH1 (Homo sapiens) 6480464 TPH1 protein affects the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:30562058 Tph1 Rat dextran sulfate multiple interactions ISO Tph1 (Mus musculus) 6480464 Granisetron inhibits the reaction [Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of TPH1 protein]] and Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of TPH1 protein] CTD PMID:30611738 Tph1 Rat dextran sulfate increases expression ISO Tph1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of TPH1 protein CTD PMID:30611738 Tph1 Rat diarsenic trioxide decreases expression ISO Tph1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TPH1 mRNA CTD PMID:23392890 and PMID:23518225 Tph1 Rat diarsenic trioxide multiple interactions ISO Tph1 (Mus musculus) 6480464 Taurine inhibits the reaction [Arsenic Trioxide results in decreased expression of TPH1 mRNA] CTD PMID:23392890 Tph1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of TPH1 mRNA CTD PMID:18835401 Tph1 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of TPH1 mRNA CTD PMID:17452286 Tph1 Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of TPH1 mRNA CTD PMID:18835401 Tph1 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of TPH1 mRNA CTD PMID:32341500 Tph1 Rat endosulfan decreases expression ISO TPH1 (Homo sapiens) 6480464 Endosulfan results in decreased expression of TPH1 mRNA CTD PMID:26615145 Tph1 Rat fluoxetine increases expression ISO Tph1 (Mus musculus) 6480464 Fluoxetine results in increased expression of TPH1 mRNA CTD PMID:21083617 Tph1 Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of TPH1 mRNA CTD PMID:15631896 Tph1 Rat folic acid increases expression ISO Tph1 (Mus musculus) 6480464 Folic Acid results in increased expression of TPH1 mRNA CTD PMID:25006883 Tph1 Rat furan increases expression EXP 6480464 furan results in increased expression of TPH1 mRNA CTD PMID:27387713 Tph1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TPH1 mRNA CTD PMID:33387578 Tph1 Rat glucose multiple interactions ISO TPH1 (Homo sapiens) 6480464 TPH1 protein affects the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:30562058 Tph1 Rat glycidol increases expression ISO Tph1 (Mus musculus) 6480464 glycidol results in increased expression of TPH1 mRNA CTD PMID:15612046 Tph1 Rat granisetron multiple interactions ISO Tph1 (Mus musculus) 6480464 Granisetron inhibits the reaction [Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of TPH1 protein]] CTD PMID:30611738 Tph1 Rat hydrogen peroxide affects expression ISO TPH1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TPH1 protein CTD PMID:21179406 Tph1 Rat L-tryptophan multiple interactions EXP 6480464 [TPH1 protein results in increased hydroxylation of Tryptophan] which results in increased chemical synthesis of 5-Hydroxytryptophan CTD PMID:32243540 Tph1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of TPH1 mRNA CTD PMID:35283115 Tph1 Rat lithium chloride decreases expression ISO Tph1 (Mus musculus) 6480464 Lithium Chloride results in decreased expression of TPH1 mRNA CTD PMID:33901603 Tph1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TPH1 gene CTD PMID:35440735 Tph1 Rat methyl carbamate increases expression ISO Tph1 (Mus musculus) 6480464 methyl carbamate results in increased expression of TPH1 mRNA CTD PMID:15612046 Tph1 Rat monosodium L-glutamate increases expression ISO Tph1 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of TPH1 mRNA CTD PMID:22078008 Tph1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of TPH1 mRNA CTD PMID:28801915 Tph1 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of TPH1 protein CTD PMID:19716841 Tph1 Rat N-Nitrosopyrrolidine decreases expression ISO TPH1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of TPH1 mRNA CTD PMID:32234424 Tph1 Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of TPH1 mRNA CTD PMID:18835401 Tph1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TPH1 mRNA CTD PMID:35163327 Tph1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of TPH1 mRNA CTD PMID:33945839 Tph1 Rat reserpine increases activity EXP 6480464 Reserpine results in increased activity of TPH1 protein CTD PMID:8369965 Tph1 Rat reserpine decreases activity EXP 6480464 Reserpine results in decreased activity of TPH1 protein CTD PMID:8369965 Tph1 Rat sarpogrelate multiple interactions ISO TPH1 (Homo sapiens) 6480464 sarpogrelate inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 mRNA] more ... CTD PMID:34560070 and PMID:35202708 Tph1 Rat sarpogrelate multiple interactions ISO Tph1 (Mus musculus) 6480464 [sarpogrelate co-treated with Carbidopa] inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 mRNA] more ... CTD PMID:34560070 and PMID:35202708 Tph1 Rat serotonin affects abundance ISO TPH1 (Homo sapiens) 6480464 TPH1 gene polymorphism affects the abundance of Serotonin CTD PMID:17203304 Tph1 Rat serotonin multiple interactions ISO Tph1 (Mus musculus) 6480464 Granisetron inhibits the reaction [Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of TPH1 protein]] and Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of TPH1 protein] CTD PMID:30611738 Tph1 Rat serotonin increases chemical synthesis ISO Tph1 (Mus musculus) 6480464 TPH1 protein results in increased chemical synthesis of Serotonin CTD PMID:18506000 Tph1 Rat serotonin increases abundance ISO TPH1 (Homo sapiens) 6480464 TPH1 gene polymorphism results in increased abundance of Serotonin CTD PMID:18405062 Tph1 Rat silicon dioxide decreases expression ISO TPH1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of TPH1 mRNA CTD PMID:25895662 Tph1 Rat sodium arsenite multiple interactions ISO TPH1 (Homo sapiens) 6480464 TPH1 protein affects the reaction [sodium arsenite inhibits the reaction [Glucose results in increased secretion of INS protein]] and TPH1 protein affects the reaction [UGT1A6A protein affects the reaction [sodium arsenite inhibits the reaction [Glucose results in increased secretion of INS protein]]] CTD PMID:30562058 Tph1 Rat sodium arsenite decreases expression ISO Tph1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of TPH1 mRNA CTD PMID:37682722 Tph1 Rat sotorasib multiple interactions ISO TPH1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of TPH1 mRNA CTD PMID:36139627 Tph1 Rat taurine multiple interactions ISO Tph1 (Mus musculus) 6480464 Taurine inhibits the reaction [arsenic trioxide results in decreased expression of TPH1 mRNA] CTD PMID:23392890 Tph1 Rat tetrachloromethane multiple interactions ISO Tph1 (Mus musculus) 6480464 [sarpogrelate co-treated with Carbidopa] inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 mRNA] more ... CTD PMID:35202708 Tph1 Rat tetrachloromethane multiple interactions ISO TPH1 (Homo sapiens) 6480464 sarpogrelate inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 mRNA] and sarpogrelate inhibits the reaction [Carbon Tetrachloride results in increased expression of TPH1 protein] CTD PMID:35202708 Tph1 Rat tetrachloromethane increases expression ISO Tph1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TPH1 mRNA and Carbon Tetrachloride results in increased expression of TPH1 protein CTD PMID:35202708 Tph1 Rat tetrachloromethane increases expression ISO TPH1 (Homo sapiens) 6480464 Carbon Tetrachloride results in increased expression of TPH1 mRNA and Carbon Tetrachloride results in increased expression of TPH1 protein CTD PMID:35202708 Tph1 Rat trametinib multiple interactions ISO TPH1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of TPH1 mRNA CTD PMID:36139627 Tph1 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TPH1 mRNA CTD PMID:21318169
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,2-dibromoethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3,5-trinitro-1,3,5-triazinane (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-nitrotoluene (ISO) 3-Amino-1-methyl-5H-pyrido[4,3-b]indole (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-hydroxytryptophan (EXP) 5-methoxytryptamine (EXP) acrylamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsane (EXP) arsenic atom (EXP) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) cadmium dichloride (ISO) carbidopa (ISO) cefaloridine (EXP) chitosan (EXP) chlorpyrifos (EXP) cisplatin (ISO) clofibrate (EXP) curcumin (EXP) cypermethrin (EXP) D-glucose (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) dieldrin (EXP) diethyl phthalate (EXP) endosulfan (ISO) fluoxetine (EXP,ISO) folic acid (ISO) furan (EXP) gentamycin (EXP) glucose (ISO) glycidol (ISO) granisetron (ISO) hydrogen peroxide (ISO) L-tryptophan (EXP) lidocaine (EXP) lithium chloride (ISO) methoxychlor (EXP) methyl carbamate (ISO) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosomorpholine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (EXP) perfluorooctanoic acid (EXP) PhIP (EXP) reserpine (EXP) sarpogrelate (ISO) serotonin (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sotorasib (ISO) taurine (ISO) tetrachloromethane (ISO) trametinib (ISO) valproic acid (EXP)
1.
Role of the 5' untranslated region (UTR) in the tissue-specific regulation of rat tryptophan hydroxylase gene expression by stress.
Chamas F and Sabban EL, J Neurochem 2002 Aug;82(3):645-54.
2.
Immobilization stress elevates tryptophan hydroxylase mRNA and protein in the rat raphe nuclei.
Chamas FM, etal., Biol Psychiatry. 2004 Feb 1;55(3):278-83.
3.
Allelic variation at the A218C tryptophan hydroxylase polymorphism influences agitation and aggression in Alzheimer's disease.
Craig D, etal., Neurosci Lett. 2004 Jun 17;363(3):199-202.
4.
Sequence of two mRNAs encoding active rat tryptophan hydroxylase.
Darmon MC, etal., J Neurochem 1988 Jul;51(1):312-6.
5.
Platelet-derived serotonin links vascular disease and tissue fibrosis.
Dees C, etal., J Exp Med. 2011 May 9;208(5):961-72. Epub 2011 Apr 25.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Haplotype analysis reveals tryptophan hydroxylase (TPH) 1 gene variants associated with major depression.
Gizatullin R, etal., Biol Psychiatry. 2006 Feb 15;59(4):295-300. Epub 2005 Sep 13.
8.
Attention-deficit/hyperactivity disorder symptoms in offspring of mothers with impaired serotonin production.
Halmoy A, etal., Arch Gen Psychiatry. 2010 Oct;67(10):1033-43.
9.
No association between the tryptophan hydroxylase gene polymorphism and major depressive disorders and antidepressant response in a Korean population.
Ham BJ, etal., Psychiatr Genet. 2005 Dec;15(4):299-301.
10.
Posttranslational regulation of TPH1 is responsible for the nightly surge of 5-HT output in the rat pineal gland.
Huang Z, etal., J Pineal Res. 2008 Nov;45(4):506-14. Epub 2008 Aug 13.
11.
Proteasome-driven turnover of tryptophan hydroxylase is triggered by phosphorylation in RBL2H3 cells, a serotonin producing mast cell line.
Iida Y, etal., Eur J Biochem 2002 Oct;269(19):4780-8.
12.
Tryptophan hydroxylase 1 knockout and tryptophan hydroxylase 2 polymorphism: effects on hypoxic pulmonary hypertension in mice.
Izikki M, etal., Am J Physiol Lung Cell Mol Physiol. 2007 Oct;293(4):L1045-52. Epub 2007 Aug 3.
13.
Tryptophan hydroxylase 1 gene (TPH1) moderates the influence of social support on depressive symptoms in adults.
Jokela M, etal., J Affect Disord. 2007 Jun;100(1-3):191-7. Epub 2006 Nov 28.
14.
Polymorphism screening and haplotype analysis of the tryptophan hydroxylase gene (TPH1) and association with bipolar affective disorder in Taiwan.
Lai TJ, etal., BMC Med Genet. 2005 Mar 31;6:14.
15.
Association between tryptophan hydroxylase gene polymorphisms and attention deficit hyperactivity disorder in Chinese Han population.
Li J, etal., Am J Med Genet B Neuropsychiatr Genet. 2006 Mar 5;141(2):126-9.
16.
Histone acetylation and expression of mono-aminergic transmitters synthetases involved in CUS-induced depressive rats.
Liu D, etal., Exp Biol Med (Maywood). 2014 Mar;239(3):330-6. doi: 10.1177/1535370213513987. Epub 2014 Feb 4.
17.
Lack of association between the serotonin transporter and tryptophan hydroxylase gene polymorphisms and completed suicide.
Mergen H, etal., Psychiatr Genet. 2006 Apr;16(2):53.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
Genetic variants in melatonin synthesis and signaling pathway are not associated with adolescent idiopathic scoliosis.
Nelson LM, etal., Spine (Phila Pa 1976). 2011 Jan 1;36(1):37-40.
20.
TPH2 and TPH1: association of variants and interactions with heroin addiction.
Nielsen DA, etal., Behav Genet. 2008 Mar;38(2):133-50. doi: 10.1007/s10519-007-9187-7. Epub 2008 Jan 8.
21.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
22.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
23.
Pleiotropic effect of the TPH A779C polymorphism on nicotine dependence and personality.
Reuter M and Hennig J, Am J Med Genet B Neuropsychiatr Genet. 2005 Apr 5;134(1):20-4.
24.
GOA pipeline
RGD automated data pipeline
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Genetic variations in tryptophan hydroxylase in suicidal behavior: analysis and meta-analysis.
Rujescu D, etal., Biol Psychiatry. 2003 Aug 15;54(4):465-73.
27.
Childhood-onset schizophrenia and tryptophan hydroxylase gene polymorphism.
Sekizawa T, etal., Am J Med Genet B Neuropsychiatr Genet. 2004 Jul 1;128(1):24-6.
28.
A functional polymorphism in the promoter region of the tryptophan hydroxylase gene is associated with alcohol dependence in one aboriginal group in Taiwan.
Sun HS, etal., Alcohol Clin Exp Res. 2005 Jan;29(1):1-7.
29.
Association of tryptophan hydroxylase gene polymorphism with depression, anxiety and comorbid depression and anxiety in a population-based sample of postpartum Taiwanese women.
Sun HS, etal., Genes Brain Behav. 2004 Dec;3(6):328-36.
30.
Lack of association between adolescent idiopathic scoliosis and previously reported single nucleotide polymorphisms in MATN1, MTNR1B, TPH1, and IGF1 in a Japanese population.
Takahashi Y, etal., J Orthop Res. 2011 Jul;29(7):1055-8. doi: 10.1002/jor.21347. Epub 2011 Feb 9.
31.
Lack of association between the tryptophan hydroxylase gene A218C polymorphism and attention-deficit hyperactivity disorder in Chinese Han population.
Tang G, etal., Am J Med Genet. 2001 Aug 8;105(6):485-8.
32.
Association study of tryptophan hydroxylase 1 and arylalkylamine N-acetyltransferase polymorphisms with adolescent idiopathic scoliosis in Han Chinese.
Wang H, etal., Spine (Phila Pa 1976). 2008 Sep 15;33(20):2199-203.
33.
Pharmacological inhibition of gut-derived serotonin synthesis is a potential bone anabolic treatment for osteoporosis.
Yadav VK, etal., Nat Med. 2010 Mar;16(3):308-12. Epub 2010 Feb 7.
34.
Serotonin transporter and tryptophan hydroxylase gene polymorphisms in Chinese patients with generalized anxiety disorder.
You JS, etal., Psychiatr Genet. 2005 Mar;15(1):7-11.
35.
Tryptophan hydroxylase-1 gene variants associate with a group of suicidal borderline women.
Zaboli G, etal., Neuropsychopharmacology. 2006 Sep;31(9):1982-90. Epub 2006 Feb 22.
Tph1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 106,293,695 - 106,314,628 (-) NCBI GRCr8 mRatBN7.2 1 97,157,375 - 97,178,415 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 97,157,409 - 97,178,344 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 102,543,405 - 102,564,448 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 111,015,397 - 111,036,438 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 104,305,773 - 104,326,712 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 102,669,868 - 102,699,442 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 102,669,868 - 102,699,442 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 103,746,878 - 103,774,100 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 97,186,071 - 97,207,551 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 97,264,181 - 97,285,662 (-) NCBI Celera 1 91,404,769 - 91,425,505 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
TPH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 18,017,555 - 18,046,269 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 18,017,555 - 18,046,269 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 18,039,102 - 18,067,816 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 17,999,114 - 18,018,885 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 17,999,113 - 18,018,885 NCBI Celera 11 18,174,092 - 18,194,347 (-) NCBI Celera Cytogenetic Map 11 p15.1 NCBI HuRef 11 17,724,789 - 17,745,045 (-) NCBI HuRef CHM1_1 11 18,041,619 - 18,061,874 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 18,115,170 - 18,143,890 (-) NCBI T2T-CHM13v2.0
Tph1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 46,294,065 - 46,321,961 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 46,294,065 - 46,321,961 (-) Ensembl GRCm39 Ensembl GRCm38 7 46,644,641 - 46,672,537 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 46,644,641 - 46,672,537 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 53,902,501 - 53,927,907 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 46,515,218 - 46,540,579 (-) NCBI MGSCv36 mm8 Celera 7 42,121,305 - 42,146,712 (-) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 30.43 NCBI
Tph1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 32,800,477 - 32,828,501 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 32,803,417 - 32,828,682 (-) NCBI ChiLan1.0 ChiLan1.0
TPH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 20,349,567 - 20,378,423 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 20,311,362 - 20,334,990 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 18,070,576 - 18,099,539 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 17,754,885 - 17,778,076 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 17,754,893 - 17,778,076 (-) Ensembl panpan1.1 panPan2
TPH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 40,545,379 - 40,571,620 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 40,547,682 - 40,566,572 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 40,047,325 - 40,065,811 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 41,651,924 - 41,675,891 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 41,651,924 - 41,676,027 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 40,664,759 - 40,683,241 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 40,872,839 - 40,891,326 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 41,211,247 - 41,229,722 (-) NCBI UU_Cfam_GSD_1.0
Tph1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 45,056,550 - 45,082,283 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 1,096,352 - 1,115,688 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 1,090,529 - 1,116,081 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TPH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 41,075,628 - 41,109,437 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 41,075,623 - 41,109,005 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 44,133,225 - 44,170,984 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TPH1
Tph1
.
Predicted Target Of
Count of predictions: 729 Count of miRNA genes: 283 Interacting mature miRNAs: 373 Transcripts: ENSRNOT00000056109 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
D1Wox40
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 97,158,593 - 97,158,914 (+) MAPPER mRatBN7.2 Rnor_6.0 1 102,671,053 - 102,671,371 NCBI Rnor6.0 Rnor_5.0 1 103,748,063 - 103,748,381 UniSTS Rnor5.0 RGSC_v3.4 1 97,187,256 - 97,187,574 UniSTS RGSC3.4 Celera 1 91,405,954 - 91,406,272 UniSTS Cytogenetic Map 1 q22 UniSTS
This gene Tph1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
39
109
73
72
41
25
41
6
188
87
89
43
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000056109 ⟹ ENSRNOP00000052959
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 97,157,409 - 97,178,344 (-) Ensembl Rnor_6.0 Ensembl 1 102,669,868 - 102,699,442 (-) Ensembl
RefSeq Acc Id:
NM_001100634 ⟹ NP_001094104
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 106,293,695 - 106,314,628 (-) NCBI mRatBN7.2 1 97,157,409 - 97,178,344 (-) NCBI Rnor_6.0 1 102,669,868 - 102,699,442 (-) NCBI Rnor_5.0 1 103,746,878 - 103,774,100 (-) NCBI RGSC_v3.4 1 97,186,071 - 97,207,551 (-) RGD Celera 1 91,404,769 - 91,425,505 (-) RGD
Sequence:
GCTTCTCCTATAAGAGGCGGCAGCTCCCGTCCGCAGGTGACCCTCTGAACTCCAGTGGCTTTGAGGTCCTCTTTCCAGTGCCGGATCCTGCCCACTGGGTCATCTTCATTCAGATTCACCATGATTGA
hide sequence
RefSeq Acc Id:
NP_001094104 ⟸ NM_001100634
- UniProtKB:
P09810 (UniProtKB/Swiss-Prot), A6JBC3 (UniProtKB/TrEMBL)
- Sequence:
MIEDNKENKDHSSERGRVTLIFSLKNEVGGLIKALKIFQENHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFPLLKSHTTVLSVDSPDQLPEKEDVMETVPWFPKKISDLDFCANRVLLYGSE
hide sequence
Ensembl Acc Id:
ENSRNOP00000052959 ⟸ ENSRNOT00000056109
RGD ID: 13690063 Promoter ID: EPDNEW_R588 Type: single initiation site Name: Tph1_1 Description: tryptophan hydroxylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 102,699,404 - 102,699,464 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Tph1
tryptophan hydroxylase 1
Symbol and Name updated
1299863 APPROVED
2002-06-10
Tph
Tryptophan hydroxylase
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_regulation
protein turnover driven by ATP-dependent action of 26S-proteasomes
724750
