Symbol:
Sst
Name:
somatostatin
RGD ID:
3761
Description:
Predicted to enable identical protein binding activity and receptor ligand activity. Involved in several processes, including hyperosmotic response; response to acidic pH; and response to steroid hormone. Located in extracellular space and neuronal cell body. Is active in neuronal dense core vesicle. Biomarker of gastric ulcer; hypertension; and vascular dementia. Orthologous to human SST (somatostatin); PARTICIPATES IN somatostatin signaling pathway; cimetidine pharmacodynamics pathway; esomeprazole pharmacodynamics pathway; INTERACTS WITH 2,2',4,4',5,5'-hexachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Smst; somatotropin release-inhibiting factor; SRIF; SS-14; SS-28
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SST (somatostatin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Sst (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SST (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SST (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sst (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SST (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SST (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sst (somatostatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SST (somatostatin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sst (somatostatin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sst1.2 (somatostatin 1, tandem duplicate 2)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
sst1.1 (somatostatin 1, tandem duplicate 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sst.1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Is Marker For:
QTLs:
Plsm4
Bp104
Candidate Gene For:
Bvd6
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 90,461,546 - 90,462,823 (+) NCBI GRCr8 mRatBN7.2 11 76,956,896 - 76,958,173 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 76,956,896 - 76,958,173 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 85,714,888 - 85,716,167 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 78,350,097 - 78,351,376 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 77,429,193 - 77,430,472 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 80,358,172 - 80,359,449 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 80,358,211 - 80,359,444 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 80,374,262 - 80,375,447 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 79,125,031 - 79,126,216 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 79,182,619 - 79,183,805 (+) NCBI Celera 11 75,836,256 - 75,837,533 (+) NCBI Celera RH 3.4 Map 11 640.6 RGD Cytogenetic Map 11 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sst Rat (S)-nicotine decreases expression ISO Sst (Mus musculus) 6480464 Nicotine results in decreased expression of SST mRNA CTD PMID:17997037 Sst Rat 1,2-dimethylhydrazine increases expression ISO Sst (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SST mRNA CTD PMID:22206623 Sst Rat 17alpha-ethynylestradiol multiple interactions ISO Sst (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SST mRNA CTD PMID:17942748 Sst Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:19327374 Sst Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sst (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SST mRNA CTD PMID:17942748 Sst Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SST mRNA CTD PMID:32109520 Sst Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sst (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SST mRNA CTD PMID:16922920 Sst Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Sst Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of SST protein CTD PMID:16534498 Sst Rat 3',5'-cyclic AMP multiple interactions ISO SST (Homo sapiens) 6480464 [SST protein co-treated with SSTR2 protein] inhibits the reaction [Colforsin results in increased chemical synthesis of Cyclic AMP] CTD PMID:22056254 Sst Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:19327374 Sst Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO SST (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of SST mRNA CTD PMID:31326446 Sst Rat 5-aza-2'-deoxycytidine affects methylation ISO SST (Homo sapiens) 6480464 Decitabine affects the methylation of SST promoter CTD PMID:17999418 Sst Rat 5-fluorouracil increases expression ISO Sst (Mus musculus) 6480464 Fluorouracil results in increased expression of SST protein CTD PMID:21296659 Sst Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SST mRNA CTD PMID:24780913 Sst Rat 8-bromo-3',5'-cyclic GMP decreases secretion EXP 6480464 8-bromocyclic GMP results in decreased secretion of SST protein CTD PMID:17961553 Sst Rat acetic acid decreases expression ISO Sst (Mus musculus) 6480464 Acetic Acid results in decreased expression of SST protein CTD PMID:21296659 Sst Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SST mRNA CTD PMID:36328537 Sst Rat aflatoxin B1 decreases methylation ISO SST (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SST gene CTD PMID:27153756 Sst Rat all-trans-retinoic acid increases expression ISO SST (Homo sapiens) 6480464 Tretinoin results in increased expression of SST mRNA and Tretinoin results in increased expression of SST protein CTD PMID:16473924 and PMID:21934132 Sst Rat all-trans-retinol multiple interactions ISO Sst (Mus musculus) 6480464 [Vitamin A co-treated with INHBA protein] results in increased expression of SST mRNA CTD PMID:17244017 Sst Rat all-trans-retinol affects expression EXP 6480464 Vitamin A affects the expression of SST protein CTD PMID:16757122 Sst Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SST mRNA CTD PMID:16483693 Sst Rat apomorphine affects secretion EXP 6480464 Apomorphine affects the secretion of SST protein CTD PMID:17961553 Sst Rat arsenite(3-) increases methylation ISO SST (Homo sapiens) 6480464 arsenite results in increased methylation of SST promoter CTD PMID:23974009 Sst Rat belinostat increases expression ISO SST (Homo sapiens) 6480464 belinostat results in increased expression of SST mRNA CTD PMID:26272509 Sst Rat benzo[a]pyrene decreases expression ISO Sst (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SST mRNA CTD PMID:27195522 Sst Rat benzo[a]pyrene affects methylation ISO SST (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SST exon and Benzo(a)pyrene affects the methylation of SST promoter CTD PMID:27901495 Sst Rat bethanechol affects secretion EXP 6480464 Bethanechol affects the secretion of SST protein CTD PMID:19296048 Sst Rat bethanechol multiple interactions EXP 6480464 CALCA protein promotes the reaction [Bethanechol affects the secretion of SST protein] CTD PMID:19296048 Sst Rat bis(2-ethylhexyl) phthalate decreases expression ISO Sst (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SST mRNA CTD PMID:35818324 Sst Rat bisphenol A multiple interactions EXP 6480464 bisphenol A promotes the reaction [SST binds to SSTR2 protein alternative form] more ... CTD PMID:12060835 Sst Rat bisphenol A decreases expression ISO Sst (Mus musculus) 6480464 bisphenol A results in decreased expression of SST mRNA CTD PMID:32156529 and PMID:35598803 Sst Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SST mRNA CTD PMID:25181051 and PMID:34947998 Sst Rat bromochloroacetic acid increases expression ISO Sst (Mus musculus) 6480464 bromochloroacetic acid results in increased expression of SST protein CTD PMID:21296659 Sst Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of SST mRNA CTD PMID:8093704 Sst Rat capsaicin increases secretion EXP 6480464 Capsaicin results in increased secretion of SST protein CTD PMID:19296048 more ... Sst Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of SST protein CTD PMID:16938409 Sst Rat capsaicin multiple interactions EXP 6480464 AMN protein inhibits the reaction [Capsaicin results in increased expression of SST protein] CTD PMID:16938409 Sst Rat capsaicin increases expression ISO Sst (Mus musculus) 6480464 Capsaicin results in increased expression of SST protein CTD PMID:19878665 Sst Rat carbamazepine affects expression ISO SST (Homo sapiens) 6480464 Carbamazepine affects the expression of SST mRNA CTD PMID:25979313 Sst Rat CGP 52608 multiple interactions ISO SST (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SST gene] CTD PMID:28238834 Sst Rat chlormequat chloride affects expression EXP 6480464 Chlormequat affects the expression of SST protein CTD PMID:38552810 Sst Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SST mRNA CTD PMID:20682304 Sst Rat Citreoviridin increases expression ISO Sst (Mus musculus) 6480464 citreoviridin results in increased expression of SST mRNA CTD PMID:30071239 Sst Rat clozapine multiple interactions EXP 6480464 Clozapine inhibits the reaction [Dizocilpine Maleate results in decreased expression of SST mRNA] and Clozapine inhibits the reaction [Dizocilpine Maleate results in decreased expression of SST protein] CTD PMID:16567023 Sst Rat colforsin daropate hydrochloride multiple interactions ISO SST (Homo sapiens) 6480464 [SST protein co-treated with SSTR2 protein] inhibits the reaction [Colforsin results in increased chemical synthesis of Cyclic AMP] CTD PMID:22056254 Sst Rat copper(II) sulfate decreases expression ISO SST (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SST mRNA CTD PMID:19549813 Sst Rat cyclosporin A decreases expression ISO SST (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SST mRNA CTD PMID:33631201 Sst Rat cysteamine decreases expression EXP 6480464 Cysteamine results in decreased expression of SST protein CTD PMID:15778430 Sst Rat DDE multiple interactions EXP 6480464 Dichlorodiphenyl Dichloroethylene inhibits the reaction [Dietary Fats results in increased expression of SST mRNA] CTD PMID:28572628 Sst Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of SST mRNA CTD PMID:19797855 Sst Rat deguelin decreases expression ISO SST (Homo sapiens) 6480464 deguelin results in decreased expression of SST mRNA CTD PMID:33512557 Sst Rat dexamethasone decreases expression ISO SST (Homo sapiens) 6480464 Dexamethasone results in decreased expression of SST mRNA CTD PMID:25047013 Sst Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of SST mRNA CTD PMID:18636392 Sst Rat dizocilpine maleate decreases expression EXP 6480464 Dizocilpine Maleate results in decreased expression of SST mRNA and Dizocilpine Maleate results in decreased expression of SST protein CTD PMID:16567023 Sst Rat dizocilpine maleate multiple interactions EXP 6480464 Clozapine inhibits the reaction [Dizocilpine Maleate results in decreased expression of SST mRNA] and Clozapine inhibits the reaction [Dizocilpine Maleate results in decreased expression of SST protein] CTD PMID:16567023 Sst Rat dorsomorphin multiple interactions ISO SST (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sst Rat ethanol affects expression ISO Sst (Mus musculus) 6480464 Ethanol affects the expression of SST mRNA CTD PMID:30319688 Sst Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of SST mRNA CTD PMID:34547370 Sst Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SST mRNA CTD PMID:30307764 Sst Rat folic acid decreases expression ISO Sst (Mus musculus) 6480464 Folic Acid results in decreased expression of SST mRNA CTD PMID:25629700 Sst Rat fonofos increases methylation ISO SST (Homo sapiens) 6480464 Fonofos results in increased methylation of SST promoter CTD PMID:22847954 Sst Rat furan increases expression EXP 6480464 furan results in increased expression of SST mRNA CTD PMID:27387713 Sst Rat gentamycin decreases response to substance EXP 6480464 SST protein results in decreased susceptibility to Gentamicins CTD PMID:19294753 Sst Rat histamine multiple interactions EXP 6480464 SST protein inhibits the reaction [ADCYAP1 protein results in increased secretion of Histamine] and SST protein inhibits the reaction [GAST protein results in increased secretion of Histamine] CTD PMID:11164953 Sst Rat hydrogen chloride increases expression EXP 6480464 Hydrochloric Acid results in increased expression of SST protein CTD PMID:9530148 Sst Rat hydrogen peroxide decreases expression ISO SST (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of SST mRNA CTD PMID:12414654 Sst Rat kainic acid decreases expression ISO Sst (Mus musculus) 6480464 Kainic Acid results in decreased expression of SST mRNA CTD PMID:17997037 Sst Rat L-arginine increases secretion EXP 6480464 Arginine results in increased secretion of SST protein CTD PMID:17961553 Sst Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of SST mRNA CTD PMID:15372504 Sst Rat Lafutidine increases expression ISO SST (Homo sapiens) 6480464 lafutidine results in increased expression of SST protein CTD PMID:16416222 Sst Rat linsidomine increases secretion EXP 6480464 linsidomine results in increased secretion of SST protein CTD PMID:17961553 Sst Rat lipopolysaccharide increases expression ISO Sst (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SST protein CTD PMID:17291600 Sst Rat lipopolysaccharide multiple interactions ISO Sst (Mus musculus) 6480464 resiniferatoxin inhibits the reaction [Lipopolysaccharides results in increased expression of SST protein] CTD PMID:17291600 Sst Rat malathion decreases expression ISO SST (Homo sapiens) 6480464 Malathion results in decreased expression of SST mRNA CTD PMID:37047231 Sst Rat menadione decreases expression ISO SST (Homo sapiens) 6480464 Vitamin K 3 results in decreased expression of SST mRNA CTD PMID:12414654 Sst Rat mercury dibromide increases expression ISO SST (Homo sapiens) 6480464 mercuric bromide results in increased expression of SST mRNA CTD PMID:26272509 Sst Rat mercury dibromide multiple interactions ISO SST (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SST mRNA CTD PMID:27188386 Sst Rat metformin increases expression ISO Sst (Mus musculus) 6480464 Metformin results in increased expression of SST mRNA CTD PMID:23457588 Sst Rat methylmercury chloride increases expression ISO SST (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SST mRNA CTD PMID:28001369 Sst Rat methylmercury chloride decreases expression ISO SST (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SST mRNA CTD PMID:34089799 Sst Rat metronidazole multiple interactions ISO Sst (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SST mRNA] and [Vancomycin co-treated with Neomycin co-treated with Metronidazole] results in increased expression of SST mRNA CTD PMID:36535435 Sst Rat morphine increases expression ISO Sst (Mus musculus) 6480464 Morphine results in increased expression of SST mRNA CTD PMID:21178816 Sst Rat N-methyl-4-phenylpyridinium decreases expression ISO SST (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SST mRNA CTD PMID:24810058 Sst Rat neomycin multiple interactions ISO Sst (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SST mRNA] and [Vancomycin co-treated with Neomycin co-treated with Metronidazole] results in increased expression of SST mRNA CTD PMID:36535435 Sst Rat nicotine decreases expression ISO Sst (Mus musculus) 6480464 Nicotine results in decreased expression of SST mRNA CTD PMID:17997037 Sst Rat octreotide decreases secretion ISO SST (Homo sapiens) 6480464 Octreotide results in decreased secretion of SST protein CTD PMID:16601281 Sst Rat octreotide decreases expression EXP 6480464 Octreotide results in decreased expression of SST mRNA CTD PMID:9053782 Sst Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of SST mRNA CTD PMID:18636392 Sst Rat p-chloromercuribenzoic acid multiple interactions ISO SST (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SST mRNA CTD PMID:27188386 Sst Rat panobinostat multiple interactions ISO SST (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SST mRNA CTD PMID:27188386 Sst Rat panobinostat increases expression ISO SST (Homo sapiens) 6480464 panobinostat results in increased expression of SST mRNA CTD PMID:26272509 Sst Rat paracetamol affects expression ISO Sst (Mus musculus) 6480464 Acetaminophen affects the expression of SST mRNA CTD PMID:17562736 Sst Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of SST mRNA CTD PMID:15206577 Sst Rat parathion increases methylation ISO SST (Homo sapiens) 6480464 Parathion results in increased methylation of SST promoter CTD PMID:22847954 Sst Rat PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:19327374 Sst Rat phenylmercury acetate multiple interactions ISO SST (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SST mRNA CTD PMID:27188386 Sst Rat picoxystrobin decreases expression ISO SST (Homo sapiens) 6480464 picoxystrobin results in decreased expression of SST mRNA CTD PMID:33512557 Sst Rat pirinixic acid decreases expression ISO Sst (Mus musculus) 6480464 pirinixic acid results in decreased expression of SST mRNA CTD PMID:17426115 Sst Rat potassium atom increases secretion ISO SST (Homo sapiens) 6480464 Potassium results in increased secretion of SST protein CTD PMID:16601281 Sst Rat progesterone decreases expression ISO SST (Homo sapiens) 6480464 Progesterone results in decreased expression of SST mRNA CTD PMID:17404688 Sst Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of SST mRNA CTD PMID:16376865 Sst Rat resiniferatoxin multiple interactions ISO Sst (Mus musculus) 6480464 resiniferatoxin inhibits the reaction [Lipopolysaccharides results in increased expression of SST protein] CTD PMID:17291600 Sst Rat rotenone decreases expression ISO SST (Homo sapiens) 6480464 Rotenone results in decreased expression of SST mRNA CTD PMID:33512557 Sst Rat SB 431542 multiple interactions ISO SST (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sst Rat SCH 23390 affects secretion EXP 6480464 SCH 23390 affects the secretion of SST protein CTD PMID:17961553 Sst Rat sterigmatocystin increases expression EXP 6480464 Sterigmatocystin results in increased expression of SST mRNA CTD PMID:34126181 Sst Rat sulpiride increases secretion EXP 6480464 Sulpiride results in increased secretion of SST protein CTD PMID:17961553 Sst Rat tamoxifen multiple interactions EXP 6480464 Tamoxifen promotes the reaction [SST protein results in decreased secretion of GH1 protein] CTD PMID:1350760 Sst Rat tebufenpyrad decreases expression ISO SST (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of SST mRNA CTD PMID:33512557 Sst Rat terbufos increases methylation ISO SST (Homo sapiens) 6480464 terbufos results in increased methylation of SST promoter CTD PMID:22847954 Sst Rat terbutaline multiple interactions ISO SST (Homo sapiens) 6480464 SST inhibits the reaction [Terbutaline results in increased expression of INS protein] CTD PMID:2563217 Sst Rat tert-butyl hydroperoxide decreases expression ISO SST (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of SST mRNA CTD PMID:12414654 Sst Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SST mRNA CTD PMID:17805973 Sst Rat Theaflavin 3,3'-digallate affects expression ISO SST (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of SST mRNA CTD PMID:34925699 Sst Rat theophylline increases secretion ISO SST (Homo sapiens) 6480464 Theophylline results in increased secretion of SST protein CTD PMID:16601281 Sst Rat thifluzamide decreases expression ISO SST (Homo sapiens) 6480464 thifluzamide results in decreased expression of SST mRNA CTD PMID:33512557 Sst Rat trichostatin A increases expression ISO SST (Homo sapiens) 6480464 trichostatin A results in increased expression of SST mRNA CTD PMID:24935251 Sst Rat triclosan decreases expression ISO SST (Homo sapiens) 6480464 Triclosan results in decreased expression of SST mRNA CTD PMID:30510588 Sst Rat Tryptanthrine increases expression ISO SST (Homo sapiens) 6480464 tryptanthrine results in increased expression of SST mRNA CTD PMID:23500671 Sst Rat valproic acid decreases expression ISO SST (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SST mRNA CTD PMID:23179753 Sst Rat valproic acid affects expression ISO SST (Homo sapiens) 6480464 Valproic Acid affects the expression of SST mRNA CTD PMID:25979313 Sst Rat vancomycin multiple interactions ISO Sst (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SST mRNA] and [Vancomycin co-treated with Neomycin co-treated with Metronidazole] results in increased expression of SST mRNA CTD PMID:36535435 Sst Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SST mRNA CTD PMID:19015723 Sst Rat zinc atom decreases expression ISO SST (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SST mRNA CTD PMID:18356318 Sst Rat zinc atom decreases secretion EXP 6480464 Zinc deficiency results in decreased secretion of SST protein CTD PMID:11842894 Sst Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of SST mRNA CTD PMID:11717422 Sst Rat zinc oxide multiple interactions ISO Sst (Mus musculus) 6480464 [Vancomycin co-treated with Neomycin co-treated with Metronidazole] promotes the reaction [Zinc Oxide results in increased expression of SST mRNA] CTD PMID:36535435 Sst Rat zinc oxide increases expression ISO Sst (Mus musculus) 6480464 Zinc Oxide analog results in increased expression of SST mRNA CTD PMID:36535435 Sst Rat zinc(0) decreases expression ISO SST (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SST mRNA CTD PMID:18356318 Sst Rat zinc(0) decreases secretion EXP 6480464 Zinc deficiency results in decreased secretion of SST protein CTD PMID:11842894 Sst Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of SST mRNA CTD PMID:11717422 Sst Rat zolpidem multiple interactions EXP 6480464 zolpidem promotes the reaction [bisphenol A promotes the reaction [SST binds to SSTR2 protein alternative form]] and zolpidem promotes the reaction [SST binds to SSTR2 protein alternative form] CTD PMID:12060835
Imported Annotations - SMPDB
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-acetamidofluorene (EXP) 3',5'-cyclic AMP (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-bromo-3',5'-cyclic GMP (EXP) acetic acid (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) all-trans-retinol (EXP,ISO) ammonium chloride (EXP) apomorphine (EXP) arsenite(3-) (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bethanechol (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromochloroacetic acid (ISO) capsaicin (EXP,ISO) carbamazepine (ISO) CGP 52608 (ISO) chlormequat chloride (EXP) chlorpyrifos (EXP) Citreoviridin (ISO) clozapine (EXP) colforsin daropate hydrochloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cysteamine (EXP) DDE (EXP) DDT (EXP) deguelin (ISO) dexamethasone (ISO) dichlorine (EXP) dizocilpine maleate (EXP) dorsomorphin (ISO) ethanol (EXP,ISO) fenvalerate (EXP) folic acid (ISO) fonofos (ISO) furan (EXP) gentamycin (EXP) histamine (EXP) hydrogen chloride (EXP) hydrogen peroxide (ISO) kainic acid (ISO) L-arginine (EXP) L-ascorbic acid (EXP) Lafutidine (ISO) linsidomine (EXP) lipopolysaccharide (ISO) malathion (ISO) menadione (ISO) mercury dibromide (ISO) metformin (ISO) methylmercury chloride (ISO) metronidazole (ISO) morphine (ISO) N-methyl-4-phenylpyridinium (ISO) neomycin (ISO) nicotine (ISO) octreotide (EXP,ISO) ozone (EXP) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) parathion (ISO) PCB138 (EXP) phenylmercury acetate (ISO) picoxystrobin (ISO) pirinixic acid (ISO) potassium atom (ISO) progesterone (EXP,ISO) resiniferatoxin (ISO) rotenone (ISO) SB 431542 (ISO) SCH 23390 (EXP) sterigmatocystin (EXP) sulpiride (EXP) tamoxifen (EXP) tebufenpyrad (ISO) terbufos (ISO) terbutaline (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) Theaflavin 3,3'-digallate (ISO) theophylline (ISO) thifluzamide (ISO) trichostatin A (ISO) triclosan (ISO) Tryptanthrine (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zinc atom (EXP,ISO) zinc oxide (ISO) zinc(0) (EXP,ISO) zolpidem (EXP)
1.
An intracellular multi-effector complex mediates somatostatin receptor 1 activation of phospho-tyrosine phosphatase eta.
Arena S, etal., Mol Endocrinol. 2007 Jan;21(1):229-46. Epub 2006 Oct 4.
2.
Increase in somatostatin immunoreactivity in the suprachiasmatic nucleus of aged Wistar rats.
Biemans BA, etal., Brain Res 2002 Dec 27;958(2):463-7.
3.
Inhibitory effect of ghrelin on insulin and pancreatic somatostatin secretion.
Egido EM, etal., Eur J Endocrinol 2002 Feb;146(2):241-4.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Biosynthesis of rat preprosomatostatin.
Goodman RH, etal., Adv Exp Med Biol 1985;188:31-47.
6.
Somatostatin-28 encoded in a cloned cDNA obtained from a rat medullary thyroid carcinoma.
Goodman RH, etal., J Biol Chem 1982 Feb 10;257(3):1156-9.
7.
Rat pre-prosomatostatin. Structure and processing by microsomal membranes.
Goodman RH, etal., J Biol Chem 1983 May 10;258(9):5570-3.
8.
Zhonghua shao shang za zhi = Zhonghua shaoshang zazhi = Chinese journal of burns
Guo X, etal., Zhonghua Shao Shang Za Zhi. 2008 Apr;24(2):111-3.
9.
Z-DNA in the rat somatostatin gene.
Hayes TE and Dixon JE, J Biol Chem 1985 Jul 5;260(13):8145-56.
10.
Regulation of rat pancreatic CCKB receptor and somatostatin expression by insulin.
Julien S, etal., Diabetes 2004 Jun;53(6):1526-34.
11.
An immunohistochemical study of endocrine cells in the stomach of hypertensive rats.
Kasacka I and Majewski M, J Physiol Pharmacol. 2007 Sep;58(3):469-78.
12.
Dopamine (D1) receptor activation and nitrinergic agents influence somatostatin levels in rat retina.
Kiagiadaki F, etal., Exp Eye Res. 2008 Jan;86(1):18-24. Epub 2007 Sep 14.
13.
NPY-, SOM- and VIP-containing interneurons in postnatal development of the rat claustrum.
Kowianski P, etal., Brain Res Bull. 2008 Aug 15;76(6):565-71. Epub 2008 May 13.
14.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
15.
Zhejiang da xue xue bao. Yi xue ban = Journal of Zhejiang University. Medical sciences
Li DQ, etal., Zhejiang Da Xue Xue Bao Yi Xue Ban. 2008 Sep;37(5):468-71.
16.
Mechanisms for regulation of gastrin and somatostatin release from isolated rat stomach during gastric distention.
Li YY World J Gastroenterol 2003 Jan;9(1):129-33.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
Primary structure of the gene encoding rat preprosomatostatin.
Montminy MR, etal., Proc Natl Acad Sci U S A 1984 Jun;81(11):3337-40.
19.
Glucagon-like peptide-1 analogue LY315902: effect on intestinal motility and release of insulin and somatostatin.
Naslund E, etal., Regul Pept 2002 Jun 15;106(1-3):89-95.
20.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.
Antidepressants Influence Somatostatin Levels and Receptor Pharmacology in Brain.
Pallis E, etal., Neuropsychopharmacology. 2008 Sep 17.
22.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
23.
GOA pipeline
RGD automated data pipeline
24.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
25.
Release of regulatory gut peptides somatostatin, neurotensin and vasoactive intestinal peptide by acid and hyperosmolal solutions in the intestine in conscious rats.
Rudholm T, etal., Regul Pept. 2009 Jan 8;152(1-3):8-12. Epub 2008 Oct 10.
26.
Somatostatin suppresses ghrelin secretion from the rat stomach.
Shimada M, etal., Biochem Biophys Res Commun 2003 Mar 14;302(3):520-5.
27.
Effect of high temperature on gastrin, somatostatin and motilin production in ulcerous gastric antral mucosa of rats.
Sun FP, etal., Di Yi Jun Yi Da Xue Xue Bao 2002 Jul;22(7):605-7.
28.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
29.
Gamma-aminobutyrate, gastrin releasing peptide, serotonin, somatostatin, and vasopressin: ultrastructural immunocytochemical localization in presynaptic axons in the suprachiasmatic nucleus.
van den Pol AN, Neuroscience. 1986 Mar;17(3):643-59. doi: 10.1016/0306-4522(86)90037-0.
30.
Somatostatin in the rat periventricular nucleus: sex differences and effect of gonadal steroids.
Van Vugt HH, etal., Exp Brain Res. 2008 Jul;188(4):483-91. Epub 2008 Apr 18.
31.
Zhongguo Zhong xi yi jie he za zhi Zhongguo Zhongxiyi jiehe zazhi = Chinese journal of integrated traditional and Western medicine / Zhongguo Zhong xi yi jie he xue hui, Zhongguo Zhong yi yan jiu yuan zhu ban
Zhang Z, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2007 Oct;27(10):916-8.
Sst Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 90,461,546 - 90,462,823 (+) NCBI GRCr8 mRatBN7.2 11 76,956,896 - 76,958,173 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 76,956,896 - 76,958,173 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 85,714,888 - 85,716,167 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 78,350,097 - 78,351,376 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 77,429,193 - 77,430,472 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 80,358,172 - 80,359,449 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 80,358,211 - 80,359,444 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 80,374,262 - 80,375,447 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 79,125,031 - 79,126,216 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 79,182,619 - 79,183,805 (+) NCBI Celera 11 75,836,256 - 75,837,533 (+) NCBI Celera RH 3.4 Map 11 640.6 RGD Cytogenetic Map 11 q23 NCBI
SST Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 187,668,912 - 187,670,394 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 187,668,912 - 187,670,394 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 187,386,700 - 187,388,182 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 188,869,388 - 188,870,895 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 188,869,406 - 188,870,808 NCBI Celera 3 185,817,667 - 185,819,174 (-) NCBI Celera Cytogenetic Map 3 q27.3 NCBI HuRef 3 184,791,007 - 184,792,514 (-) NCBI HuRef CHM1_1 3 187,349,954 - 187,351,461 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 190,486,363 - 190,487,845 (-) NCBI T2T-CHM13v2.0
Sst Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 23,708,327 - 23,710,041 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 23,708,323 - 23,709,708 (-) Ensembl GRCm39 Ensembl GRCm38 16 23,889,573 - 23,891,342 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 23,889,573 - 23,890,958 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 23,889,667 - 23,890,930 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 23,804,930 - 23,806,193 (-) NCBI MGSCv36 mm8 Celera 16 24,439,585 - 24,440,848 (-) NCBI Celera Cytogenetic Map 16 B1 NCBI cM Map 16 15.0 NCBI
SST Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 185,539,811 - 185,541,321 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 185,544,525 - 185,546,059 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 184,695,561 - 184,697,091 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 193,156,526 - 193,158,020 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 193,155,363 - 193,158,337 (-) Ensembl panpan1.1 panPan2
SST Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 20,063,091 - 20,064,520 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 20,063,090 - 20,064,557 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 24,155,973 - 24,157,402 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 19,983,105 - 19,984,534 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 19,983,111 - 19,984,571 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 20,011,742 - 20,013,171 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 20,005,493 - 20,006,922 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 20,245,365 - 20,246,794 (-) NCBI UU_Cfam_GSD_1.0
Sst Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 116,372,454 - 116,373,819 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936578 2,464,212 - 2,465,701 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936578 2,464,310 - 2,465,673 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SST Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 125,337,418 - 125,338,850 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 125,337,560 - 125,338,742 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 134,621,119 - 134,622,301 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SST Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 81,946,287 - 81,947,775 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 81,946,206 - 81,947,790 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 55,444,092 - 55,445,581 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sst
.
Predicted Target Of
Count of predictions: 91 Count of miRNA genes: 70 Interacting mature miRNAs: 75 Transcripts: ENSRNOT00000002519 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 634339 Niddm50 Non-insulin dependent diabetes mellitus QTL 50 3.32 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 66422148 86241447 Rat 1549848 Bvd6 Brain ventricular dilatation QTL 6 3.1 0.0001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 66113321 82169223 Rat 10450831 Scl80 Serum cholesterol level QTL 80 4.7 0.01 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 11 76957131 83051965 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 1354656 Bvd3 Brain ventricular dilatation QTL 3 3.64 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 69446070 82846715 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 1354593 Stl12 Serum triglyceride level QTL 12 3.36 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 11 66422148 86241447 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
D11Wox2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 11 90,460,886 - 90,461,030 (+) Marker Load Pipeline mRatBN7.2 11 76,956,236 - 76,956,380 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,357,513 - 80,357,656 NCBI Rnor6.0 Rnor_5.0 11 80,376,053 - 80,376,196 UniSTS Rnor5.0 RGSC_v3.4 11 79,124,281 - 79,124,425 RGD RGSC3.4 RGSC_v3.4 11 79,124,282 - 79,124,425 UniSTS RGSC3.4 RGSC_v3.1 11 79,181,870 - 79,182,014 RGD Celera 11 75,835,597 - 75,835,740 UniSTS RH 3.4 Map 11 641.6 RGD RH 3.4 Map 11 641.6 UniSTS Cytogenetic Map 11 q23 UniSTS
D11Arb1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,956,235 - 76,956,458 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,357,512 - 80,357,734 NCBI Rnor6.0 Rnor_5.0 11 80,375,975 - 80,376,197 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,030 - 79,126,216 RGD RGSC3.4 RGSC_v3.4 11 79,124,281 - 79,124,503 UniSTS RGSC3.4 RGSC_v3.1 11 79,181,869 - 79,182,092 RGD Celera 11 75,835,596 - 75,835,818 UniSTS Cytogenetic Map 11 q23 UniSTS
D11Mit7
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 11 80,376,056 - 80,376,248 NCBI Rnor5.0 RGSC_v3.4 11 79,124,230 - 79,124,421 RGD RGSC3.4 RGSC_v3.1 11 79,181,819 - 79,182,010 RGD SHRSP x BN Map 11 35.6998 RGD SHRSP x BN Map 11 35.6998 UniSTS FHH x ACI Map 11 53.9499 RGD Cytogenetic Map 11 q23 UniSTS
X51468
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,958,038 - 76,958,134 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,359,315 - 80,359,410 NCBI Rnor6.0 Rnor_5.0 11 80,374,298 - 80,374,394 NCBI Rnor5.0 RGSC_v3.4 11 79,126,084 - 79,126,179 UniSTS RGSC3.4 Celera 11 75,837,399 - 75,837,494 UniSTS Cytogenetic Map 11 q23 UniSTS
PMC24644P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,957,150 - 76,957,936 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,358,427 - 80,359,212 NCBI Rnor6.0 Rnor_5.0 11 80,374,497 - 80,375,282 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,196 - 79,125,981 UniSTS RGSC3.4 Celera 11 75,836,511 - 75,837,296 UniSTS Cytogenetic Map 11 q23 UniSTS
RH127971
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,957,846 - 76,958,066 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,359,123 - 80,359,342 NCBI Rnor6.0 Rnor_5.0 11 80,374,367 - 80,374,586 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,892 - 79,126,111 UniSTS RGSC3.4 Celera 11 75,837,207 - 75,837,426 UniSTS RH 3.4 Map 11 641.0 UniSTS Cytogenetic Map 11 q23 UniSTS
RH94876
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,957,507 - 76,957,766 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,358,784 - 80,359,042 NCBI Rnor6.0 Rnor_5.0 11 80,374,667 - 80,374,925 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,553 - 79,125,811 UniSTS RGSC3.4 Celera 11 75,836,868 - 75,837,126 UniSTS RH 3.4 Map 11 640.6 UniSTS Cytogenetic Map 11 q23 UniSTS
PMC123023P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,957,801 - 76,957,988 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,359,078 - 80,359,264 NCBI Rnor6.0 Rnor_5.0 11 80,374,445 - 80,374,631 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,847 - 79,126,033 UniSTS RGSC3.4 Celera 11 75,837,162 - 75,837,348 UniSTS Cytogenetic Map 11 q23 UniSTS
UniSTS:256695
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 76,956,974 - 76,957,827 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,358,251 - 80,359,103 NCBI Rnor6.0 Rnor_5.0 11 80,374,606 - 80,375,458 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,020 - 79,125,872 UniSTS RGSC3.4 Celera 11 75,836,335 - 75,837,187 UniSTS Cytogenetic Map 11 q23 UniSTS
SST-112F
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 11 90,461,781 - 90,462,486 (+) Marker Load Pipeline mRatBN7.2 11 76,957,131 - 76,957,836 (+) MAPPER mRatBN7.2 Rnor_6.0 11 80,358,408 - 80,359,112 NCBI Rnor6.0 Rnor_5.0 11 80,374,597 - 80,375,301 UniSTS Rnor5.0 RGSC_v3.4 11 79,125,177 - 79,125,881 UniSTS RGSC3.4 Celera 11 75,836,492 - 75,837,196 UniSTS Cytogenetic Map 11 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
3
18
100
57
56
35
16
35
3
115
41
90
27
43
21
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002519 ⟹ ENSRNOP00000002519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 76,956,896 - 76,958,173 (+) Ensembl Rnor_6.0 Ensembl 11 80,358,211 - 80,359,444 (+) Ensembl
RefSeq Acc Id:
NM_012659 ⟹ NP_036791
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 90,461,546 - 90,462,823 (+) NCBI mRatBN7.2 11 76,956,896 - 76,958,173 (+) NCBI Rnor_6.0 11 80,358,172 - 80,359,449 (+) NCBI Rnor_5.0 11 80,374,262 - 80,375,447 (-) NCBI RGSC_v3.4 11 79,125,031 - 79,126,216 (+) RGD Celera 11 75,836,256 - 75,837,533 (+) NCBI
Sequence:
GCTGACGTCAGAGAGAGAGTTTAAAAAGGGGAGACCGTGGAGAGCTCGATAGCGGCTGAAGGAGACGCTACTGGAGTCGTCTCTGCTGCCTGCGGACCTGCGTCTAGACTGACCCACCGCGCTCAAGC
hide sequence
RefSeq Acc Id:
NP_036791 ⟸ NM_012659
- Peptide Label:
precursor
- UniProtKB:
P60042 (UniProtKB/Swiss-Prot), A6JS12 (UniProtKB/TrEMBL)
- Sequence:
MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
hide sequence
Ensembl Acc Id:
ENSRNOP00000002519 ⟸ ENSRNOT00000002519
RGD ID: 13698241 Promoter ID: EPDNEW_R8766 Type: single initiation site Name: Sst_1 Description: somatostatin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 80,358,222 - 80,358,282 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Sst
somatostatin
Somatostatin
Symbol and Name updated
629477 APPROVED
2002-06-10
Sst
Somatostatin
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in medullary thyroid carcinoma
730224
gene_function
binds to specific high-affinity receptors on the cell surface
gene_process
regulates endocrine and nervous system function
gene_process
inhibits somatotropin release
gene_protein
synthesized as a preprosomatostatin which is 116 amino acids; prosomatostatin is 92 amino acids
730108
gene_protein
synthesized as a preprosomatostatin which is 116 amino acids; prosomatostatin is 92 amino acids
730224
gene_protein
active protein forms are somatostatin-14 (SS-14) and somatostatin-28 (SS-28) formed by cleavage from a precursor polypeptide
1299051
gene_regulation
secretion by pancreas is inhibited by ghrelin
1299052
