Symbol:
Rho
Name:
rhodopsin
RGD ID:
3573
Description:
Enables retinal binding activity and spectrin binding activity. Involved in G protein-coupled opsin signaling pathway and red, far-red light phototransduction. Located in photoreceptor outer segment membrane and rough endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in congenital stationary night blindness autosomal dominant 1; fundus albipunctatus; night blindness; retinitis pigmentosa; and retinitis pigmentosa 4. Orthologous to human RHO (rhodopsin); PARTICIPATES IN altered visual phototransduction pathway; retinitis pigmentosa pathway; retinoid cycle metabolic pathway; INTERACTS WITH 3,7-dihydropurine-6-thione; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Rhodopsin (retinitis pigmentosa 4, autosomal dominant)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RHO (rhodopsin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Rho (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rho (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RHO (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RHO (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rho (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RHO (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RHO (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rho (rhodopsin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Rho (rhodopsin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RHO (rhodopsin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rhol (rhodopsin, like)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
rho (rhodopsin)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rho
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 150,653,205 - 150,658,367 (+) NCBI GRCr8 mRatBN7.2 4 148,975,597 - 148,988,693 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 148,980,611 - 148,985,773 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 155,209,107 - 155,214,199 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 150,993,130 - 150,998,222 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 149,616,029 - 149,621,121 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 147,832,136 - 147,837,298 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 147,832,136 - 147,837,298 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 211,115,847 - 211,121,009 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 152,057,788 - 152,062,950 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 152,302,628 - 152,307,791 (+) NCBI Celera 4 137,870,273 - 137,875,435 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rho Rat 1,2-dichloroethane increases expression ISO Rho (Mus musculus) 6480464 ethylene dichloride results in increased expression of RHO mRNA CTD PMID:28960355 Rho Rat 17beta-estradiol decreases expression ISO RHO (Homo sapiens) 6480464 Estradiol results in decreased expression of RHO mRNA CTD PMID:31614463 Rho Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO RHO (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Rho Rat 2-hydroxypropanoic acid increases expression ISO RHO (Homo sapiens) 6480464 Lactic Acid results in increased expression of RHO mRNA CTD PMID:30851411 Rho Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RHO (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 Rho Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of RHO mRNA CTD PMID:23358152 Rho Rat aflatoxin B1 increases methylation ISO RHO (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of RHO gene CTD PMID:27153756 Rho Rat Aflatoxin B2 alpha decreases methylation ISO RHO (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of RHO exon CTD PMID:30157460 Rho Rat Alkannin multiple interactions ISO Rho (Mus musculus) 6480464 alkannin inhibits the reaction [lipopolysaccharide more ... CTD PMID:30924981 Rho Rat Alkannin multiple interactions ISO RHO (Homo sapiens) 6480464 alkannin inhibits the reaction [lipopolysaccharide more ... CTD PMID:30924981 Rho Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RHO mRNA CTD PMID:16483693 Rho Rat astragaloside IV multiple interactions ISO Rho (Mus musculus) 6480464 astragaloside A inhibits the reaction [[Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA] CTD PMID:33285147 Rho Rat benzo[a]pyrene affects methylation ISO RHO (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RHO 3' UTR CTD PMID:27901495 Rho Rat benzo[e]pyrene decreases methylation ISO RHO (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of RHO exon CTD PMID:30157460 Rho Rat bisphenol A increases expression ISO RHO (Homo sapiens) 6480464 bisphenol A results in increased expression of RHO mRNA CTD PMID:23146750 Rho Rat bisphenol A decreases methylation ISO Rho (Mus musculus) 6480464 bisphenol A results in decreased methylation of RHO promoter CTD PMID:27312807 Rho Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RHO gene CTD PMID:28505145 Rho Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RHO mRNA CTD PMID:25181051 Rho Rat dexamethasone multiple interactions ISO RHO (Homo sapiens) 6480464 Dexamethasone inhibits the reaction [lipopolysaccharide more ... CTD PMID:30924981 Rho Rat dexamethasone multiple interactions ISO Rho (Mus musculus) 6480464 Dexamethasone inhibits the reaction [lipopolysaccharide more ... CTD PMID:30924981 Rho Rat diethyl maleate increases expression ISO RHO (Homo sapiens) 6480464 diethyl maleate results in increased expression of RHO mRNA CTD PMID:33545341 Rho Rat dioxygen multiple interactions ISO Rho (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of RHO mRNA CTD PMID:30529165 Rho Rat diquat decreases expression ISO Rho (Mus musculus) 6480464 Diquat results in decreased expression of RHO protein CTD PMID:36851058 Rho Rat fasudil multiple interactions ISO RHO (Homo sapiens) 6480464 fasudil inhibits the reaction [lipopolysaccharide more ... CTD PMID:30088170 and PMID:30924981 Rho Rat fasudil multiple interactions EXP 6480464 fasudil inhibits the reaction [Paraquat results in increased expression of RHO protein] CTD PMID:30088170 Rho Rat fasudil multiple interactions ISO Rho (Mus musculus) 6480464 fasudil inhibits the reaction [lipopolysaccharide more ... CTD PMID:30924981 Rho Rat gentamycin increases expression ISO Rho (Mus musculus) 6480464 Gentamicins results in increased expression of RHO protein mutant form CTD PMID:18644591 Rho Rat iron atom multiple interactions ISO Rho (Mus musculus) 6480464 [Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA and astragaloside A inhibits the reaction [[Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA] CTD PMID:33285147 Rho Rat iron dextran multiple interactions ISO Rho (Mus musculus) 6480464 [Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA and astragaloside A inhibits the reaction [[Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA] CTD PMID:33285147 Rho Rat iron(0) multiple interactions ISO Rho (Mus musculus) 6480464 [Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA and astragaloside A inhibits the reaction [[Iron-Dextran Complex results in increased abundance of Iron] which results in decreased expression of RHO mRNA] CTD PMID:33285147 Rho Rat lead diacetate multiple interactions ISO Rho (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of RHO mRNA and [lead acetate results in increased abundance of Lead] which results in decreased expression of RHO protein CTD PMID:28050121 Rho Rat lead(0) multiple interactions ISO Rho (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of RHO mRNA and [lead acetate results in increased abundance of Lead] which results in decreased expression of RHO protein CTD PMID:28050121 Rho Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of RHO mRNA CTD PMID:23358152 Rho Rat methapyrilene decreases methylation ISO RHO (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of RHO exon CTD PMID:30157460 Rho Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Rho (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of RHO gene CTD PMID:16332273 Rho Rat okadaic acid decreases expression ISO Rho (Mus musculus) 6480464 Okadaic Acid results in decreased expression of RHO mRNA CTD PMID:25270620 Rho Rat paraquat increases expression ISO RHO (Homo sapiens) 6480464 Paraquat results in increased expression of RHO protein CTD PMID:30088170 Rho Rat paraquat multiple interactions EXP 6480464 fasudil inhibits the reaction [Paraquat results in increased expression of RHO protein] CTD PMID:30088170 Rho Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of RHO protein CTD PMID:30088170 Rho Rat paraquat multiple interactions ISO RHO (Homo sapiens) 6480464 fasudil inhibits the reaction [Paraquat results in increased expression of RHO protein] CTD PMID:30088170 Rho Rat potassium chloride multiple interactions ISO RHO (Homo sapiens) 6480464 [Dronabinol results in decreased susceptibility to Potassium Chloride] which results in increased expression of RHO mRNA CTD PMID:29691375 Rho Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of RHO mRNA CTD PMID:23358152 Rho Rat rac-lactic acid increases expression ISO RHO (Homo sapiens) 6480464 Lactic Acid results in increased expression of RHO mRNA CTD PMID:30851411 Rho Rat resveratrol multiple interactions ISO RHO (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of RHO mRNA CTD PMID:23557933 Rho Rat sulforaphane multiple interactions ISO Rho (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of RHO mRNA CTD PMID:30529165 Rho Rat titanium dioxide increases expression ISO Rho (Mus musculus) 6480464 titanium dioxide results in increased expression of RHO mRNA CTD PMID:23557971 and PMID:35295148 Rho Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of RHO mRNA CTD PMID:33387578 Rho Rat triptonide increases expression ISO Rho (Mus musculus) 6480464 triptonide results in increased expression of RHO mRNA CTD PMID:33045310 Rho Rat valproic acid affects expression ISO Rho (Mus musculus) 6480464 Valproic Acid affects the expression of RHO mRNA CTD PMID:17292431 Rho Rat valproic acid increases methylation ISO RHO (Homo sapiens) 6480464 Valproic Acid results in increased methylation of RHO gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,7-dihydropurine-6-thione (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) Alkannin (ISO) ammonium chloride (EXP) astragaloside IV (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) dexamethasone (ISO) diethyl maleate (ISO) dioxygen (ISO) diquat (ISO) fasudil (EXP,ISO) gentamycin (ISO) iron atom (ISO) iron dextran (ISO) iron(0) (ISO) lead diacetate (ISO) lead(0) (ISO) mercaptopurine (EXP) methapyrilene (ISO) N-ethyl-N-nitrosourea (ISO) okadaic acid (ISO) paraquat (EXP,ISO) potassium chloride (ISO) purine-6-thiol (EXP) rac-lactic acid (ISO) resveratrol (ISO) sulforaphane (ISO) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO)
Biological Process
absorption of visible light (ISS) cellular response to light stimulus (IBA,IEA,ISO) detection of light stimulus (IEA,ISO) detection of temperature stimulus involved in thermoception (IEA,ISO) G protein-coupled opsin signaling pathway (IDA) G protein-coupled receptor signaling pathway (IBA,IEA,ISO) gene expression (IEA,ISO) microtubule cytoskeleton organization (IEA,ISO) photoreceptor cell maintenance (IEA,ISO) phototransduction (IBA,IEA,ISO) podosome assembly (IEA,ISO) protein phosphorylation (ISO) red, far-red light phototransduction (IDA) response to light intensity (IEA,ISO) response to light stimulus (IEA,ISO) retina development in camera-type eye (IEA,ISO) rod bipolar cell differentiation (IEA,ISO) sensory perception of light stimulus (IEA,ISO) signal transduction (IEA) thermotaxis (IEA,ISO) visual perception (IEA,ISO)
Cellular Component
cell projection (IEA) cell-cell junction (IEA,ISO) Golgi apparatus (IEA,ISO) membrane (IEA,ISS) photoreceptor disc membrane (IEA,ISO,ISS) photoreceptor inner segment (IEA,ISO) photoreceptor inner segment membrane (IEA,ISO,ISS) photoreceptor outer segment (IBA,IDA,IEA,ISO) photoreceptor outer segment membrane (IDA,IEA,ISO,ISS) plasma membrane (IBA,IEA,ISO,ISS) rod photoreceptor outer segment (IEA,ISO) rough endoplasmic reticulum membrane (IDA) sperm head plasma membrane (IEA,ISO) sperm midpiece (IEA,ISO)
1.
A homozygous p.Glu150Lys mutation in the opsin gene of two Pakistani families with autosomal recessive retinitis pigmentosa.
Azam M, etal., Mol Vis. 2009 Dec 3;15:2526-34.
2.
Aberrant retinal tight junction and adherens junction protein expression in an animal model of autosomal dominant Retinitis pigmentosa: the Rho(-/-) mouse.
Campbell M, etal., Exp Eye Res. 2006 Sep;83(3):484-92. Epub 2006 Apr 27.
3.
Caspase-7 ablation modulates UPR, reprograms TRAF2-JNK apoptosis and protects T17M rhodopsin mice from severe retinal degeneration.
Choudhury S, etal., Cell Death Dis. 2013 Mar 7;4:e528. doi: 10.1038/cddis.2013.34.
4.
Genes and mutations causing retinitis pigmentosa.
Daiger SP, etal., Clin Genet. 2013 Aug;84(2):132-41. doi: 10.1111/cge.12203. Epub 2013 Jun 19.
5.
Rhodopsin in immature rod outer segments.
Dodge J, etal., Invest Ophthalmol Vis Sci. 1996 Sep;37(10):1951-6.
6.
Mutations within the rhodopsin gene in patients with autosomal dominant retinitis pigmentosa.
Dryja TP, etal., N Engl J Med. 1990 Nov 8;323(19):1302-7.
7.
Heterozygous missense mutation in the rhodopsin gene as a cause of congenital stationary night blindness.
Dryja TP, etal., Nat Genet. 1993 Jul;4(3):280-3.
8.
Interaction of GABA receptor/channel rho(1) and gamma(2) subunit.
Ekema GM, etal., Invest Ophthalmol Vis Sci. 2002 Jul;43(7):2326-33.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Preservation of photoreceptor morphology and function in P23H rats using an allele independent ribozyme.
Gorbatyuk M, etal., Exp Eye Res. 2007 Jan;84(1):44-52. Epub 2006 Nov 1.
12.
Phosphorylation of the InaD gene product, a photoreceptor membrane protein required for recovery of visual excitation.
Huber A, etal., J Biol Chem 1996 May 17;271(20):11710-7.
13.
Identification of an IMPDH1 mutation in autosomal dominant retinitis pigmentosa (RP10) revealed following comparative microarray analysis of transcripts derived from retinas of wild-type and Rho(-/-) mice.
Kennan A, etal., Hum Mol Genet. 2002 Mar 1;11(5):547-57.
14.
Transport of truncated rhodopsin and its effects on rod function and degeneration.
Lee ES and Flannery JG, Invest Ophthalmol Vis Sci. 2007 Jun;48(6):2868-76.
15.
AAV delivery of wild-type rhodopsin preserves retinal function in a mouse model of autosomal dominant retinitis pigmentosa.
Mao H, etal., Hum Gene Ther. 2011 May;22(5):567-75. doi: 10.1089/hum.2010.140. Epub 2011 Mar 7.
16.
Functional characterization of a novel c.614-622del rhodopsin mutation in a French pedigree with retinitis pigmentosa.
Maubaret C, etal., Mol Vis. 2012;18:581-7. Epub 2012 Mar 2.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
Rhodopsin C110Y mutation causes a type 2 autosomal dominant retinitis pigmentosa.
Milla E, etal., Ophthalmic Genet. 1998 Sep;19(3):131-9.
19.
Zinc-finger-based transcriptional repression of rhodopsin in a model of dominant retinitis pigmentosa.
Mussolino C, etal., EMBO Mol Med. 2011 Mar;3(3):118-28. doi: 10.1002/emmm.201000119. Epub 2011 Jan 26.
20.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
22.
Identification of two mutations of the RHO gene in two Chinese families with retinitis pigmentosa: correlation between genotype and phenotype.
Pan Z, etal., Mol Vis. 2012;18:3013-20. Epub 2012 Dec 14.
23.
The giant spectrin betaV couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
Papal S, etal., Hum Mol Genet. 2013 Sep 15;22(18):3773-88. doi: 10.1093/hmg/ddt228. Epub 2013 May 23.
24.
Enhanced cone dysfunction in rats homozygous for the P23H rhodopsin mutation.
Pinilla I, etal., Neurosci Lett. 2005 Jul 1-8;382(1-2):16-21. Epub 2005 Mar 17.
25.
Generation, characterization, and molecular cloning of the Noerg-1 mutation of rhodopsin in the mouse.
Pinto LH, etal., Vis Neurosci. 2005 Sep-Oct;22(5):619-29.
26.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
27.
GOA pipeline
RGD automated data pipeline
28.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
Comprehensive gene review and curation
RGD comprehensive gene curation
31.
Rhodopsin p.N78I dominant mutation causing sectorial retinitis pigmentosa in a pedigree with intrafamilial clinical heterogeneity.
Rivera-De la Parra D, etal., Gene. 2013 Apr 25;519(1):173-6. doi: 10.1016/j.gene.2013.01.048. Epub 2013 Feb 9.
32.
Mice with a D190N mutation in the gene encoding rhodopsin: a model for human autosomal-dominant retinitis pigmentosa.
Sancho-Pelluz J, etal., Mol Med. 2012 May 9;18:549-55. doi: 10.2119/molmed.2011.00475.
33.
Addition of the chromophore to rat rhodopsin is an early post-translational event.
St Jules RS, etal., Exp Eye Res. 1989 May;48(5):653-65.
34.
The localization and timing of post-translational modifications of rat rhodopsin.
St Jules RS, etal., Exp Eye Res. 1990 Oct;51(4):427-34.
35.
Membrane receptors and transporters involved in the function and transport of vitamin A and its derivatives.
Sun H Biochim Biophys Acta. 2012 Jan;1821(1):99-112. Epub 2011 Jun 17.
36.
Photoreceptor degeneration: genetic and mechanistic dissection of a complex trait.
Wright AF, etal., Nat Rev Genet. 2010 Apr;11(4):273-84. doi: 10.1038/nrg2717.
Rho Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 150,653,205 - 150,658,367 (+) NCBI GRCr8 mRatBN7.2 4 148,975,597 - 148,988,693 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 148,980,611 - 148,985,773 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 155,209,107 - 155,214,199 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 150,993,130 - 150,998,222 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 149,616,029 - 149,621,121 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 147,832,136 - 147,837,298 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 147,832,136 - 147,837,298 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 211,115,847 - 211,121,009 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 152,057,788 - 152,062,950 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 152,302,628 - 152,307,791 (+) NCBI Celera 4 137,870,273 - 137,875,435 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
RHO Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 129,528,639 - 129,535,344 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 129,528,639 - 129,535,344 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 129,247,482 - 129,254,187 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 130,730,172 - 130,736,877 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 130,730,179 - 130,736,885 NCBI Celera 3 127,674,318 - 127,681,023 (+) NCBI Celera Cytogenetic Map 3 q22.1 NCBI HuRef 3 126,630,783 - 126,637,404 (+) NCBI HuRef CHM1_1 3 129,210,611 - 129,217,316 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 132,273,081 - 132,279,773 (+) NCBI T2T-CHM13v2.0
Rho Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 115,903,741 - 115,916,999 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 115,908,709 - 115,916,997 (+) Ensembl GRCm39 Ensembl GRCm38 6 115,926,754 - 115,940,038 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 115,931,748 - 115,940,036 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 115,881,945 - 115,888,848 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 115,897,546 - 115,904,449 (+) NCBI MGSCv36 mm8 Celera 6 117,767,245 - 117,774,151 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.72 NCBI
Rho Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 17,787,337 - 17,791,982 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 17,787,337 - 17,791,982 (-) NCBI ChiLan1.0 ChiLan1.0
RHO Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 127,461,364 - 127,471,171 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 127,466,088 - 127,473,896 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 126,586,510 - 126,593,028 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 133,938,419 - 133,944,928 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 133,938,419 - 133,944,928 (+) Ensembl panpan1.1 panPan2
RHO Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 5,630,735 - 5,638,906 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 5,669,643 - 5,674,903 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 5,661,948 - 5,667,219 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 5,661,632 - 5,667,315 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 5,377,793 - 5,383,047 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 5,730,818 - 5,736,090 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 5,706,443 - 5,711,705 (-) NCBI UU_Cfam_GSD_1.0
Rho
RHO Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 68,908,578 - 68,913,651 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 68,908,578 - 68,913,651 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 76,135,867 - 76,140,946 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RHO Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 51,513,611 - 51,520,589 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 51,515,081 - 51,519,974 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 114,957,244 - 114,963,876 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rho
.
Predicted Target Of
Count of predictions: 85 Count of miRNA genes: 62 Interacting mature miRNAs: 76 Transcripts: ENSRNOT00000064603 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
28
109
37
37
10
15
10
5
124
60
91
41
60
27
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064603 ⟹ ENSRNOP00000061473
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 148,980,611 - 148,985,773 (+) Ensembl Rnor_6.0 Ensembl 4 147,832,136 - 147,837,298 (+) Ensembl
RefSeq Acc Id:
NM_033441 ⟹ NP_254276
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 150,653,205 - 150,658,367 (+) NCBI mRatBN7.2 4 148,980,611 - 148,985,773 (+) NCBI Rnor_6.0 4 147,832,136 - 147,837,298 (+) NCBI Rnor_5.0 4 211,115,847 - 211,121,009 (+) NCBI RGSC_v3.4 4 152,057,788 - 152,062,950 (+) RGD Celera 4 137,870,273 - 137,875,435 (+) RGD
Sequence:
GGAGCCGTAGGTAGCTGAGCTCGCCAGGCAGCCTTGGTCTCTGTCTACGAACAGCCCGTGGGGCAGCCTCAAGGGCCGCAGCCATGAACGGCACAGAGGGCCCCAATTTTTATGTGCCCTTCTCCAAC
hide sequence
RefSeq Acc Id:
NP_254276 ⟸ NM_033441
- UniProtKB:
P51489 (UniProtKB/Swiss-Prot), A0A0G2JSY7 (UniProtKB/TrEMBL), A6IL03 (UniProtKB/TrEMBL)
- Sequence:
MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIGLWSL
hide sequence
Ensembl Acc Id:
ENSRNOP00000061473 ⟸ ENSRNOT00000064603
RGD ID: 13693329 Promoter ID: EPDNEW_R3854 Type: single initiation site Name: Rho_1 Description: rhodopsin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 147,832,122 - 147,832,182 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Rho
Rhodopsin (retinitis pigmentosa 4, autosomal dominant)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
mutations in the human homolog are a major cause of retinitis pigmentosa
731249
