Symbol:
Pdgfra
Name:
platelet derived growth factor receptor alpha
RGD ID:
3284
Description:
Enables phosphatidylinositol 3-kinase binding activity and platelet-derived growth factor alpha-receptor activity. Involved in several processes, including lung growth; positive regulation of branching involved in lung morphogenesis; and positive regulation of peptidyl-tyrosine phosphorylation. Located in several cellular components, including axon; nucleus; and plasma membrane. Used to study middle cerebral artery infarction. Biomarker of chronic ulcer of skin; hypertension; oligohydramnios; pulmonary fibrosis; and sciatic neuropathy. Human ortholog(s) of this gene implicated in hematologic cancer (multiple); hypereosinophilic syndrome; and pancreatic cancer. Orthologous to human PDGFRA (platelet derived growth factor receptor alpha); PARTICIPATES IN platelet-derived growth factor signaling pathway; calcium/calcium-mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha platelet-derived growth factor receptor; alpha-type platelet-derived growth factor receptor; APDGFR; CD140 antigen-like family member A; LOC102554024; PDGF-R-alpha; PDGFACE; PDGFR-alpha; platelet derived growth factor receptor, alpha polypeptide; platelet-derived growth factor alpha receptor; Platelet-derived growth factor receptor alpha; platelet-derived growth factor receptor alpha-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PDGFRA (platelet derived growth factor receptor alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pdgfra (platelet derived growth factor receptor, alpha polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pdgfra (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PDGFRA (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PDGFRA (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pdgfra (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PDGFRA (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PDGFRA (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pdgfra (platelet derived growth factor receptor alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Pdgfra (platelet derived growth factor receptor, alpha polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PDGFRA (platelet derived growth factor receptor alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdgfra (platelet-derived growth factor receptor, alpha polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pvr
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PhylomeDB)
Caenorhabditis elegans (roundworm):
ver-1
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
pdgfra
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 33,360,027 - 33,408,604 (-) NCBI GRCr8 mRatBN7.2 14 33,005,838 - 33,054,347 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 33,005,839 - 33,054,335 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 33,356,581 - 33,405,000 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 34,664,393 - 34,712,811 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 33,149,650 - 33,198,062 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 35,527,926 - 35,581,130 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 35,527,927 - 35,581,031 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 35,356,434 - 35,409,311 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 35,369,422 - 35,418,126 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 35,369,672 - 35,418,126 (-) NCBI Celera 14 32,273,077 - 32,324,887 (-) NCBI Celera RH 3.4 Map 14 432.47 RGD Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdgfra Rat 1,1-dichloroethene decreases expression ISO Pdgfra (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PDGFRA mRNA CTD PMID:26682919 Pdgfra Rat 1,2-dichloroethane increases expression ISO Pdgfra (Mus musculus) 6480464 ethylene dichloride results in increased expression of PDGFRA mRNA CTD PMID:28189721 and PMID:28960355 Pdgfra Rat 1,2-dimethylhydrazine multiple interactions ISO Pdgfra (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PDGFRA mRNA CTD PMID:22206623 Pdgfra Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PDGFRA mRNA CTD PMID:25380136 Pdgfra Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PDGFRA mRNA CTD PMID:17557909 Pdgfra Rat 17beta-estradiol affects expression ISO Pdgfra (Mus musculus) 6480464 Estradiol affects the expression of PDGFRA mRNA CTD PMID:15598610 Pdgfra Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PDGFRA mRNA CTD PMID:32741896 Pdgfra Rat 17beta-estradiol increases expression ISO Pdgfra (Mus musculus) 6480464 Estradiol results in increased expression of PDGFRA mRNA CTD PMID:19484750 and PMID:39298647 Pdgfra Rat 17beta-estradiol multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Estradiol co-treated with Progesterone co-treated with Cuprizone] results in increased expression of PDGFRA mRNA CTD PMID:19031445 Pdgfra Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PDGFRA mRNA CTD PMID:32741896 Pdgfra Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Pdgfra (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pdgfra Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Pdgfra (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pdgfra Rat 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Pdgfra Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pdgfra (Mus musculus) 6480464 SRC protein promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of PDGFRA mRNA] CTD PMID:14708085 Pdgfra Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pdgfra (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PDGFRA mRNA CTD PMID:14708085 more ... Pdgfra Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pdgfra (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PDGFRA mRNA CTD PMID:21570461 Pdgfra Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PDGFRA mRNA CTD PMID:22298810 and PMID:34747641 Pdgfra Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pdgfra (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pdgfra Rat 2-butoxyethanol decreases expression ISO Pdgfra (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PDGFRA mRNA CTD PMID:19812364 Pdgfra Rat 3,3',5-triiodo-L-thyronine decreases expression EXP 6480464 Triiodothyronine results in decreased expression of PDGFRA protein CTD PMID:25200619 Pdgfra Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Pdgfra (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PDGFRA mRNA CTD PMID:26251327 Pdgfra Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PDGFRA mRNA CTD PMID:28522335 Pdgfra Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDGFRA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PDGFRA mRNA CTD PMID:28628672 Pdgfra Rat 4,4'-sulfonyldiphenol decreases expression ISO PDGFRA (Homo sapiens) 6480464 bisphenol S results in decreased expression of PDGFRA mRNA CTD PMID:25912373 Pdgfra Rat 4,4'-sulfonyldiphenol affects methylation ISO Pdgfra (Mus musculus) 6480464 bisphenol S affects the methylation of PDGFRA gene CTD PMID:31683443 Pdgfra Rat 4,4'-sulfonyldiphenol affects methylation ISO PDGFRA (Homo sapiens) 6480464 bisphenol S affects the methylation of PDGFRA gene CTD PMID:31601247 Pdgfra Rat 4,4'-sulfonyldiphenol increases expression ISO Pdgfra (Mus musculus) 6480464 bisphenol S results in increased expression of PDGFRA mRNA CTD PMID:30951980 Pdgfra Rat 4-vinylcyclohexene dioxide affects expression ISO Pdgfra (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of PDGFRA mRNA CTD PMID:20829426 Pdgfra Rat 5-aza-2'-deoxycytidine affects expression ISO PDGFRA (Homo sapiens) 6480464 Decitabine affects the expression of PDGFRA mRNA CTD PMID:23300844 Pdgfra Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PDGFRA mRNA CTD PMID:24780913 Pdgfra Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PDGFRA mRNA CTD PMID:31881176 Pdgfra Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PDGFRA mRNA CTD PMID:36328537 Pdgfra Rat acrylamide increases expression ISO PDGFRA (Homo sapiens) 6480464 Acrylamide results in increased expression of PDGFRA mRNA CTD PMID:38554842 Pdgfra Rat aflatoxin B1 decreases methylation ISO PDGFRA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PDGFRA gene CTD PMID:27153756 Pdgfra Rat aflatoxin B1 decreases expression ISO PDGFRA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PDGFRA mRNA CTD PMID:28943387 Pdgfra Rat aldrin multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Pdgfra Rat all-trans-retinoic acid decreases expression ISO Pdgfra (Mus musculus) 6480464 Tretinoin results in decreased expression of PDGFRA protein CTD PMID:16956736 Pdgfra Rat all-trans-retinoic acid multiple interactions ISO Pdgfra (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of PDGFRA mRNA and [bisphenol F co-treated with Tretinoin] results in decreased expression of PDGFRA mRNA CTD PMID:30951980 Pdgfra Rat all-trans-retinoic acid increases expression ISO PDGFRA (Homo sapiens) 6480464 Tretinoin results in increased expression of PDGFRA mRNA CTD PMID:21934132 and PMID:23724009 Pdgfra Rat all-trans-retinoic acid increases expression ISO Pdgfra (Mus musculus) 6480464 Tretinoin results in increased expression of PDGFRA mRNA CTD PMID:16604517 Pdgfra Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PDGFRA mRNA CTD PMID:16483693 Pdgfra Rat arsane increases methylation ISO PDGFRA (Homo sapiens) 6480464 Arsenic results in increased methylation of PDGFRA promoter CTD PMID:21291286 Pdgfra Rat arsane multiple interactions ISO Pdgfra (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which affects the expression of PDGFRA protein and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PDGFRA mRNA CTD PMID:35378173 and PMID:38310360 Pdgfra Rat arsenic atom increases methylation ISO PDGFRA (Homo sapiens) 6480464 Arsenic results in increased methylation of PDGFRA promoter CTD PMID:21291286 Pdgfra Rat arsenic atom multiple interactions ISO Pdgfra (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which affects the expression of PDGFRA protein and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PDGFRA mRNA CTD PMID:35378173 and PMID:38310360 Pdgfra Rat arsenite(3-) increases methylation ISO PDGFRA (Homo sapiens) 6480464 arsenite results in increased methylation of PDGFRA promoter CTD PMID:23974009 Pdgfra Rat Azoxymethane multiple interactions ISO Pdgfra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDGFRA mRNA CTD PMID:29950665 Pdgfra Rat benzo[a]pyrene decreases expression ISO PDGFRA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PDGFRA mRNA CTD PMID:22316170 Pdgfra Rat benzo[a]pyrene decreases methylation ISO PDGFRA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PDGFRA promoter CTD PMID:27901495 Pdgfra Rat benzo[a]pyrene affects methylation ISO PDGFRA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PDGFRA 5' UTR and Benzo(a)pyrene affects the methylation of PDGFRA exon CTD PMID:27901495 Pdgfra Rat benzo[a]pyrene decreases expression ISO Pdgfra (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PDGFRA mRNA CTD PMID:22610609 Pdgfra Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of PDGFRA mRNA and [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of PDGFRA protein CTD PMID:25031359 Pdgfra Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of PDGFRA mRNA and Diethylhexyl Phthalate results in decreased expression of PDGFRA protein CTD PMID:25031359 Pdgfra Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PDGFRA mRNA and bisphenol A results in increased expression of PDGFRA protein CTD PMID:12604637 and PMID:33296240 Pdgfra Rat bisphenol A increases expression ISO Pdgfra (Mus musculus) 6480464 bisphenol A results in increased expression of PDGFRA mRNA CTD PMID:35598803 Pdgfra Rat bisphenol A affects methylation ISO PDGFRA (Homo sapiens) 6480464 bisphenol A affects the methylation of PDGFRA gene CTD PMID:31601247 Pdgfra Rat bisphenol A increases expression ISO PDGFRA (Homo sapiens) 6480464 bisphenol A results in increased expression of PDGFRA mRNA CTD PMID:29275510 Pdgfra Rat bisphenol A multiple interactions ISO Pdgfra (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of PDGFRA mRNA CTD PMID:30951980 Pdgfra Rat bisphenol A multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDGFRA mRNA CTD PMID:28628672 Pdgfra Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PDGFRA mRNA CTD PMID:25181051 Pdgfra Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PDGFRA mRNA and bisphenol A results in decreased expression of PDGFRA protein CTD PMID:25084756 more ... Pdgfra Rat bisphenol AF decreases expression ISO PDGFRA (Homo sapiens) 6480464 bisphenol AF results in decreased expression of PDGFRA mRNA CTD PMID:25912373 Pdgfra Rat bisphenol F multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PDGFRA mRNA CTD PMID:28628672 Pdgfra Rat bisphenol F increases expression ISO Pdgfra (Mus musculus) 6480464 bisphenol F results in increased expression of PDGFRA mRNA CTD PMID:30951980 Pdgfra Rat bisphenol F multiple interactions ISO Pdgfra (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of PDGFRA mRNA CTD PMID:30951980 Pdgfra Rat cadmium atom increases phosphorylation ISO PDGFRA (Homo sapiens) 6480464 Cadmium results in increased phosphorylation of PDGFRA protein CTD PMID:17125913 Pdgfra Rat cadmium atom multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PDGFRA mRNA and fulvestrant inhibits the reaction [Cadmium results in increased phosphorylation of PDGFRA protein] CTD PMID:17125913 and PMID:29741670 Pdgfra Rat cadmium dichloride increases phosphorylation ISO PDGFRA (Homo sapiens) 6480464 Cadmium Chloride results in increased phosphorylation of PDGFRA protein CTD PMID:17125913 Pdgfra Rat cadmium dichloride increases expression ISO PDGFRA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PDGFRA mRNA CTD PMID:33129824 Pdgfra Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PDGFRA mRNA CTD PMID:33453195 Pdgfra Rat cadmium dichloride multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in decreased expression of PDGFRA mRNA CTD PMID:19840844 Pdgfra Rat cadmium dichloride multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PDGFRA mRNA and fulvestrant inhibits the reaction [Cadmium Chloride results in increased phosphorylation of PDGFRA protein] CTD PMID:17125913 and PMID:29741670 Pdgfra Rat carbofuran decreases expression EXP 6480464 Carbofuran results in decreased expression of PDGFRA mRNA and Carbofuran results in decreased expression of PDGFRA protein CTD PMID:30471306 Pdgfra Rat carbon nanotube affects expression ISO Pdgfra (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of PDGFRA mRNA CTD PMID:25554681 Pdgfra Rat carbon nanotube decreases expression ISO Pdgfra (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PDGFRA mRNA CTD PMID:25554681 Pdgfra Rat choline multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PDGFRA mRNA CTD PMID:20548288 and PMID:20938992 Pdgfra Rat chromium(6+) affects expression ISO Pdgfra (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PDGFRA mRNA CTD PMID:28472532 Pdgfra Rat cisplatin decreases expression ISO Pdgfra (Mus musculus) 6480464 Cisplatin results in decreased expression of PDGFRA mRNA CTD PMID:21151649 Pdgfra Rat cisplatin affects expression ISO PDGFRA (Homo sapiens) 6480464 Cisplatin affects the expression of PDGFRA mRNA CTD PMID:23300844 Pdgfra Rat copper atom multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PDGFRA mRNA CTD PMID:20971185 Pdgfra Rat copper(0) multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PDGFRA mRNA CTD PMID:20971185 Pdgfra Rat coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of PDGFRA mRNA and Coumestrol results in increased expression of PDGFRA protein CTD PMID:12604637 Pdgfra Rat Cuprizon multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Estradiol co-treated with Progesterone co-treated with Cuprizone] results in increased expression of PDGFRA mRNA CTD PMID:19031445 Pdgfra Rat cyclosporin A decreases expression ISO PDGFRA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PDGFRA mRNA CTD PMID:27989131 Pdgfra Rat DDD multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Pdgfra Rat DDE multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Pdgfra Rat DDT increases expression EXP 6480464 DDT results in increased expression of PDGFRA mRNA CTD PMID:30207508 Pdgfra Rat dermatan sulfate decreases expression ISO PDGFRA (Homo sapiens) 6480464 Dermatan Sulfate results in decreased expression of PDGFRA mRNA CTD PMID:16945567 Pdgfra Rat dexamethasone increases expression ISO Pdgfra (Mus musculus) 6480464 Dexamethasone results in increased expression of PDGFRA mRNA CTD PMID:22733784 Pdgfra Rat dexamethasone multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDGFRA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PDGFRA mRNA CTD PMID:28628672 Pdgfra Rat dextran sulfate multiple interactions ISO Pdgfra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDGFRA mRNA CTD PMID:29950665 Pdgfra Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PDGFRA mRNA CTD PMID:21266533 Pdgfra Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PDGFRA mRNA CTD PMID:24893172 Pdgfra Rat dieldrin multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Pdgfra Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PDGFRA mRNA and Diethylstilbestrol results in increased expression of PDGFRA protein CTD PMID:12604637 Pdgfra Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of PDGFRA mRNA CTD PMID:37567419 Pdgfra Rat Diosbulbin B increases expression ISO Pdgfra (Mus musculus) 6480464 diosbulbin B results in increased expression of PDGFRA mRNA CTD PMID:39368342 Pdgfra Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of PDGFRA mRNA CTD PMID:26476374 Pdgfra Rat dioxygen increases expression ISO Pdgfra (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PDGFRA mRNA CTD PMID:24205000 Pdgfra Rat dioxygen multiple interactions EXP 6480464 Quercetin inhibits the reaction [Oxygen deficiency results in increased expression of PDGFRA mRNA] CTD PMID:26476374 Pdgfra Rat diquat decreases expression ISO Pdgfra (Mus musculus) 6480464 Diquat results in decreased expression of PDGFRA mRNA CTD PMID:36851058 Pdgfra Rat disodium selenite multiple interactions ISO Pdgfra (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [Hydrogen Peroxide results in decreased expression of PDGFRA mRNA] CTD PMID:17997286 Pdgfra Rat disodium selenite decreases expression EXP 6480464 Sodium Selenite results in decreased expression of PDGFRA mRNA CTD PMID:18209489 Pdgfra Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PDGFRA mRNA CTD PMID:25152437 Pdgfra Rat diuron increases expression ISO Pdgfra (Mus musculus) 6480464 Diuron results in increased expression of PDGFRA mRNA CTD PMID:37949197 Pdgfra Rat diuron increases expression EXP 6480464 Diuron results in increased expression of PDGFRA mRNA CTD PMID:21551480 Pdgfra Rat divanadium pentaoxide increases expression EXP 6480464 vanadium pentoxide results in increased expression of PDGFRA mRNA CTD PMID:17134509 Pdgfra Rat dorsomorphin multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pdgfra Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of PDGFRA mRNA CTD PMID:37597758 Pdgfra Rat doxorubicin decreases expression ISO PDGFRA (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PDGFRA mRNA CTD PMID:29803840 Pdgfra Rat doxorubicin multiple interactions EXP 6480464 Phosphocreatine inhibits the reaction [Doxorubicin results in increased expression of PDGFRA mRNA] CTD PMID:37597758 Pdgfra Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PDGFRA mRNA CTD PMID:29391264 Pdgfra Rat ethanol affects splicing ISO Pdgfra (Mus musculus) 6480464 Ethanol affects the splicing of PDGFRA mRNA CTD PMID:30319688 Pdgfra Rat ethanol increases expression ISO Pdgfra (Mus musculus) 6480464 Ethanol results in increased expression of PDGFRA mRNA CTD PMID:30319688 Pdgfra Rat folic acid multiple interactions ISO Pdgfra (Mus musculus) 6480464 [1 more ... CTD PMID:20548288 more ... Pdgfra Rat folic acid affects methylation ISO PDGFRA (Homo sapiens) 6480464 Folic Acid affects the methylation of PDGFRA 5' UTR CTD PMID:29546377 Pdgfra Rat folic acid affects response to substance ISO PDGFRA (Homo sapiens) 6480464 PDGFRA 5' UTR SNP affects the susceptibility to Folic Acid CTD PMID:29546377 Pdgfra Rat formaldehyde increases expression ISO PDGFRA (Homo sapiens) 6480464 Formaldehyde results in increased expression of PDGFRA mRNA CTD PMID:18045764 Pdgfra Rat formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of PDGFRA mRNA CTD PMID:18045764 Pdgfra Rat fulvestrant multiple interactions ISO PDGFRA (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Cadmium Chloride results in increased phosphorylation of PDGFRA protein] and fulvestrant inhibits the reaction [Cadmium results in increased phosphorylation of PDGFRA protein] CTD PMID:17125913 Pdgfra Rat fulvestrant decreases methylation ISO PDGFRA (Homo sapiens) 6480464 Fulvestrant results in decreased methylation of PDGFRA gene CTD PMID:31601247 Pdgfra Rat furan increases expression EXP 6480464 furan results in increased expression of PDGFRA mRNA CTD PMID:27387713 Pdgfra Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of PDGFRA gene CTD PMID:27387713 Pdgfra Rat furosemide affects expression EXP 6480464 Furosemide affects the expression of PDGFRA mRNA CTD PMID:16526316 Pdgfra Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PDGFRA mRNA and Genistein results in increased expression of PDGFRA protein CTD PMID:12604637 Pdgfra Rat genistein decreases expression ISO PDGFRA (Homo sapiens) 6480464 Genistein results in decreased expression of PDGFRA mRNA CTD PMID:22228119 Pdgfra Rat genistein multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of PDGFRA mRNA and [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of PDGFRA protein CTD PMID:25031359 Pdgfra Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of PDGFRA mRNA and Genistein results in decreased expression of PDGFRA protein CTD PMID:25031359 Pdgfra Rat heparin decreases expression ISO PDGFRA (Homo sapiens) 6480464 Heparin results in decreased expression of PDGFRA mRNA CTD PMID:16945567 Pdgfra Rat hydrogen peroxide decreases expression ISO Pdgfra (Mus musculus) 6480464 Hydrogen Peroxide results in decreased expression of PDGFRA mRNA CTD PMID:17997286 Pdgfra Rat hydrogen peroxide multiple interactions EXP 6480464 [nitrofen results in increased expression of [PDGFA protein co-treated with PDGFRA protein]] which results in increased abundance of Hydrogen Peroxide CTD PMID:20920717 Pdgfra Rat hydrogen peroxide multiple interactions ISO Pdgfra (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [Hydrogen Peroxide results in decreased expression of PDGFRA mRNA] CTD PMID:17997286 Pdgfra Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of PDGFRA mRNA CTD PMID:17440234 Pdgfra Rat indometacin multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PDGFRA mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PDGFRA mRNA CTD PMID:28628672 Pdgfra Rat inulin multiple interactions ISO Pdgfra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PDGFRA mRNA CTD PMID:36331819 Pdgfra Rat iron dichloride decreases expression ISO PDGFRA (Homo sapiens) 6480464 ferrous chloride results in decreased expression of PDGFRA mRNA CTD PMID:35984750 Pdgfra Rat L-methionine multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PDGFRA mRNA CTD PMID:20548288 and PMID:20938992 Pdgfra Rat lead diacetate multiple interactions EXP 6480464 CBL protein affects the reaction [lead acetate results in decreased expression of PDGFRA protein] more ... CTD PMID:17298174 Pdgfra Rat lead diacetate multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of PDGFRA mRNA CTD PMID:32458983 Pdgfra Rat lead(0) multiple interactions EXP 6480464 CBL protein affects the reaction [Lead results in decreased expression of PDGFRA protein] more ... CTD PMID:17298174 Pdgfra Rat lead(0) multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of PDGFRA mRNA CTD PMID:32458983 Pdgfra Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PDGFRA mRNA CTD PMID:24136188 Pdgfra Rat lipopolysaccharide multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PDGFRA mRNA CTD PMID:35811015 Pdgfra Rat lovastatin decreases expression EXP 6480464 Lovastatin results in decreased expression of PDGFRA mRNA CTD PMID:20578043 Pdgfra Rat maneb multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of PDGFRA mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of PDGFRA mRNA] CTD PMID:23963992 Pdgfra Rat masitinib decreases activity ISO PDGFRA (Homo sapiens) 6480464 masitinib results in decreased activity of PDGFRA protein CTD PMID:19789626 Pdgfra Rat melatonin multiple interactions ISO Pdgfra (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of PDGFRA mRNA] CTD PMID:23963992 Pdgfra Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PDGFRA mRNA CTD PMID:28619521 Pdgfra Rat methylisothiazolinone increases expression ISO PDGFRA (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of PDGFRA mRNA CTD PMID:31629900 Pdgfra Rat methylmercury chloride increases expression ISO PDGFRA (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PDGFRA mRNA CTD PMID:34328791 Pdgfra Rat microcystin-LR increases expression ISO Pdgfra (Mus musculus) 6480464 cyanoginosin LR results in increased expression of PDGFRA mRNA CTD PMID:17654400 Pdgfra Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of PDGFRA mRNA CTD PMID:25972201 Pdgfra Rat monosodium L-glutamate multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in decreased expression of PDGFRA mRNA CTD PMID:19001666 Pdgfra Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in decreased expression of PDGFRA mRNA more ... CTD PMID:19840844 Pdgfra Rat N-nitrosodiethylamine multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of PDGFRA mRNA CTD PMID:24535843 Pdgfra Rat N-nitrosodiethylamine decreases expression ISO Pdgfra (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of PDGFRA mRNA CTD PMID:24535843 Pdgfra Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of PDGFRA mRNA CTD PMID:25380136 Pdgfra Rat N-phosphocreatine multiple interactions EXP 6480464 Phosphocreatine inhibits the reaction [Doxorubicin results in increased expression of PDGFRA mRNA] CTD PMID:37597758 Pdgfra Rat N-phosphocreatine decreases expression EXP 6480464 Phosphocreatine results in decreased expression of PDGFRA mRNA CTD PMID:37597758 Pdgfra Rat nitrofen multiple interactions EXP 6480464 [nitrofen results in increased expression of [PDGFA protein co-treated with PDGFRA protein]] which results in increased abundance of Hydrogen Peroxide CTD PMID:20920717 Pdgfra Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PDGFRA mRNA and nitrofen results in increased expression of PDGFRA protein CTD PMID:20920717 Pdgfra Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PDGFRA gene CTD PMID:30521419 Pdgfra Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of PDGFRA mRNA CTD PMID:21703336 Pdgfra Rat ochratoxin A multiple interactions EXP 6480464 SHH protein modified form inhibits the reaction [ochratoxin A results in decreased expression of PDGFRA mRNA] CTD PMID:21703336 Pdgfra Rat okadaic acid multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in decreased expression of PDGFRA mRNA CTD PMID:19840844 Pdgfra Rat oxybenzone decreases expression ISO Pdgfra (Mus musculus) 6480464 oxybenzone results in decreased expression of PDGFRA mRNA CTD PMID:39343157 Pdgfra Rat oxycodone increases expression EXP 6480464 Oxycodone results in increased expression of PDGFRA protein CTD PMID:26377394 Pdgfra Rat ozone multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PDGFRA mRNA CTD PMID:34911549 Pdgfra Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of PDGFRA mRNA CTD PMID:27638505 Pdgfra Rat panobinostat multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDGFRA mRNA CTD PMID:27188386 Pdgfra Rat panobinostat increases expression ISO PDGFRA (Homo sapiens) 6480464 panobinostat results in increased expression of PDGFRA mRNA CTD PMID:26272509 Pdgfra Rat paracetamol affects expression ISO Pdgfra (Mus musculus) 6480464 Acetaminophen affects the expression of PDGFRA mRNA CTD PMID:17562736 Pdgfra Rat paraquat multiple interactions EXP 6480464 CBL protein affects the reaction [Paraquat results in decreased expression of PDGFRA protein] more ... CTD PMID:17298174 Pdgfra Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PDGFRA mRNA CTD PMID:32680482 Pdgfra Rat paraquat multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of PDGFRA mRNA and Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in increased expression of PDGFRA mRNA] CTD PMID:23963992 Pdgfra Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of PDGFRA mRNA CTD PMID:16854511 Pdgfra Rat paraquat increases expression ISO Pdgfra (Mus musculus) 6480464 Paraquat results in increased expression of PDGFRA mRNA and Paraquat results in increased expression of PDGFRA mRNA alternative form CTD PMID:17215068 and PMID:21371552 Pdgfra Rat PCB138 multiple interactions ISO Pdgfra (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pdgfra Rat pentanal increases expression ISO PDGFRA (Homo sapiens) 6480464 pentanal results in increased expression of PDGFRA mRNA CTD PMID:26079696 Pdgfra Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pdgfra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PDGFRA mRNA CTD PMID:36331819 Pdgfra Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PDGFRA mRNA CTD PMID:19162173 Pdgfra Rat phenobarbital multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of PDGFRA mRNA CTD PMID:24535843 Pdgfra Rat phenobarbital affects expression ISO Pdgfra (Mus musculus) 6480464 Phenobarbital affects the expression of PDGFRA mRNA CTD PMID:23091169 Pdgfra Rat phenylmercury acetate increases expression ISO PDGFRA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PDGFRA mRNA CTD PMID:26272509 Pdgfra Rat phenylmercury acetate multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDGFRA mRNA CTD PMID:27188386 Pdgfra Rat phorbol 13-acetate 12-myristate multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in decreased expression of PDGFRA mRNA CTD PMID:19840844 Pdgfra Rat pioglitazone multiple interactions ISO Pdgfra (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of PDGFRA mRNA CTD PMID:27935865 Pdgfra Rat pirinixic acid multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PDGFRA mRNA CTD PMID:19710929 Pdgfra Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PDGFRA mRNA CTD PMID:12832660 Pdgfra Rat ponatinib decreases activity ISO PDGFRA (Homo sapiens) 6480464 ponatinib analog results in decreased activity of PDGFRA protein more ... CTD PMID:19878872 and PMID:21561767 Pdgfra Rat ponatinib decreases phosphorylation ISO PDGFRA (Homo sapiens) 6480464 ponatinib results in decreased phosphorylation of PDGFRA protein mutant form CTD PMID:21482694 Pdgfra Rat potassium dichromate increases expression ISO Pdgfra (Mus musculus) 6480464 Potassium Dichromate results in increased expression of PDGFRA mRNA CTD PMID:23608068 Pdgfra Rat progesterone multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [Progesterone results in increased secretion of [VEGFA protein binds to VEGFA protein]] which results in increased phosphorylation of PDGFRA protein more ... CTD PMID:16888808 and PMID:17614352 Pdgfra Rat progesterone increases expression ISO Pdgfra (Mus musculus) 6480464 Progesterone results in increased expression of PDGFRA mRNA CTD PMID:22238285 Pdgfra Rat progesterone multiple interactions ISO Pdgfra (Mus musculus) 6480464 [Estradiol co-treated with Progesterone co-treated with Cuprizone] results in increased expression of PDGFRA mRNA CTD PMID:19031445 Pdgfra Rat propanal increases expression ISO PDGFRA (Homo sapiens) 6480464 propionaldehyde results in increased expression of PDGFRA mRNA CTD PMID:26079696 Pdgfra Rat protein kinase inhibitor multiple interactions ISO PDGFRA (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [tricarbonyldichlororuthenium (II) dimer results in increased phosphorylation of PDGFRA protein] CTD PMID:26385185 Pdgfra Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Oxygen deficiency results in increased expression of PDGFRA mRNA] CTD PMID:26476374 Pdgfra Rat raloxifene affects expression ISO PDGFRA (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of PDGFRA mRNA CTD PMID:14699072 Pdgfra Rat remdesivir decreases expression ISO Pdgfra (Mus musculus) 6480464 remdesivir results in decreased expression of PDGFRA mRNA CTD PMID:35605700 Pdgfra Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PDGFRA (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PDGFRA mRNA CTD PMID:35811015 Pdgfra Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PDGFRA mRNA CTD PMID:35811015 Pdgfra Rat SB 431542 multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pdgfra Rat serpentine asbestos decreases expression ISO Pdgfra (Mus musculus) 6480464 Asbestos and Serpentine results in decreased expression of PDGFRA mRNA CTD PMID:16251409 Pdgfra Rat serpentine asbestos increases expression EXP 6480464 Asbestos more ... CTD PMID:8392089 and PMID:9603151 Pdgfra Rat silicon dioxide decreases expression ISO PDGFRA (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PDGFRA mRNA CTD PMID:25895662 Pdgfra Rat silver atom decreases expression ISO Pdgfra (Mus musculus) 6480464 Silver results in decreased expression of PDGFRA mRNA CTD PMID:27131904 Pdgfra Rat silver(0) decreases expression ISO Pdgfra (Mus musculus) 6480464 Silver results in decreased expression of PDGFRA mRNA CTD PMID:27131904 Pdgfra Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of PDGFRA mRNA CTD PMID:16414398 Pdgfra Rat sodium arsenate increases expression ISO Pdgfra (Mus musculus) 6480464 sodium arsenate results in increased expression of PDGFRA mRNA CTD PMID:21795629 Pdgfra Rat sodium arsenite multiple interactions ISO Pdgfra (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which affects the expression of PDGFRA protein and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PDGFRA mRNA CTD PMID:35378173 and PMID:38310360 Pdgfra Rat sodium arsenite increases expression ISO Pdgfra (Mus musculus) 6480464 sodium arsenite results in increased expression of PDGFRA mRNA CTD PMID:37682722 Pdgfra Rat sodium chloride increases expression ISO PDGFRA (Homo sapiens) 6480464 Sodium Chloride results in increased expression of PDGFRA mRNA CTD PMID:23634900 Pdgfra Rat sorafenib decreases phosphorylation ISO PDGFRA (Homo sapiens) 6480464 sorafenib results in decreased phosphorylation of PDGFRA protein mutant form CTD PMID:21482694 Pdgfra Rat streptozocin decreases expression ISO Pdgfra (Mus musculus) 6480464 Streptozocin results in decreased expression of PDGFRA mRNA CTD PMID:26073000 Pdgfra Rat sunitinib decreases phosphorylation ISO PDGFRA (Homo sapiens) 6480464 sunitinib results in decreased phosphorylation of PDGFRA protein mutant form CTD PMID:21482694 Pdgfra Rat sunitinib decreases expression ISO PDGFRA (Homo sapiens) 6480464 Sunitinib results in decreased expression of PDGFRA mRNA CTD PMID:31533062 Pdgfra Rat tacrolimus hydrate increases expression ISO Pdgfra (Mus musculus) 6480464 Tacrolimus results in increased expression of PDGFRA mRNA CTD PMID:29362864 Pdgfra Rat tamoxifen increases expression ISO Pdgfra (Mus musculus) 6480464 Tamoxifen results in increased expression of PDGFRA mRNA CTD PMID:24769059 Pdgfra Rat temozolomide increases expression ISO PDGFRA (Homo sapiens) 6480464 Temozolomide results in increased expression of PDGFRA mRNA CTD PMID:31758290 Pdgfra Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PDGFRA mRNA CTD PMID:32741896 Pdgfra Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PDGFRA mRNA CTD PMID:16239168 Pdgfra Rat tetrachloromethane affects expression ISO Pdgfra (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PDGFRA mRNA CTD PMID:17484886 Pdgfra Rat thapsigargin decreases expression ISO PDGFRA (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PDGFRA mRNA CTD PMID:22378314 Pdgfra Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PDGFRA mRNA CTD PMID:34492290 Pdgfra Rat titanium dioxide decreases expression ISO Pdgfra (Mus musculus) 6480464 titanium dioxide results in decreased expression of PDGFRA mRNA CTD PMID:23557971 and PMID:29264374 Pdgfra Rat titanium dioxide increases methylation ISO Pdgfra (Mus musculus) 6480464 titanium dioxide results in increased methylation of PDGFRA promoter CTD PMID:35295148 Pdgfra Rat titanium dioxide multiple interactions ISO Pdgfra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDGFRA mRNA CTD PMID:29950665 Pdgfra Rat trichostatin A increases expression ISO PDGFRA (Homo sapiens) 6480464 trichostatin A results in increased expression of PDGFRA mRNA CTD PMID:24935251 and PMID:26272509 Pdgfra Rat trichostatin A multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDGFRA mRNA CTD PMID:27188386 Pdgfra Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of PDGFRA mRNA CTD PMID:30589522 Pdgfra Rat tunicamycin decreases expression ISO PDGFRA (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PDGFRA mRNA CTD PMID:22378314 Pdgfra Rat valproic acid affects expression ISO PDGFRA (Homo sapiens) 6480464 Valproic Acid affects the expression of PDGFRA mRNA CTD PMID:25979313 Pdgfra Rat valproic acid multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDGFRA mRNA CTD PMID:27188386 Pdgfra Rat valproic acid increases expression ISO PDGFRA (Homo sapiens) 6480464 Valproic Acid results in increased expression of PDGFRA mRNA CTD PMID:23179753 more ... Pdgfra Rat valproic acid increases expression ISO Pdgfra (Mus musculus) 6480464 Valproic Acid results in increased expression of PDGFRA mRNA CTD PMID:19136453 and PMID:24896083 Pdgfra Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PDGFRA mRNA CTD PMID:23034163 Pdgfra Rat vismodegib decreases expression ISO PDGFRA (Homo sapiens) 6480464 HhAntag691 results in decreased expression of PDGFRA protein CTD PMID:22087285 Pdgfra Rat vismodegib multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [GLI1 mRNA co-treated with GLI2 mRNA] affects the reaction [HhAntag691 results in decreased expression of PDGFRA protein] CTD PMID:22087285 Pdgfra Rat vitamin E increases expression ISO PDGFRA (Homo sapiens) 6480464 Vitamin E results in increased expression of PDGFRA mRNA CTD PMID:19244175 Pdgfra Rat vorinostat multiple interactions ISO PDGFRA (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDGFRA mRNA CTD PMID:27188386 Pdgfra Rat vorinostat increases expression ISO PDGFRA (Homo sapiens) 6480464 vorinostat results in increased expression of PDGFRA mRNA CTD PMID:26272509 Pdgfra Rat zoledronic acid increases expression ISO PDGFRA (Homo sapiens) 6480464 zoledronic acid results in increased expression of PDGFRA mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 3,3',5-triiodo-L-thyronine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-vinylcyclohexene dioxide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbofuran (EXP) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) coumestrol (EXP) Cuprizon (ISO) cyclosporin A (ISO) DDD (ISO) DDE (ISO) DDT (EXP) dermatan sulfate (ISO) dexamethasone (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP) dieldrin (ISO) diethylstilbestrol (EXP) dimethylarsinic acid (EXP) Diosbulbin B (ISO) dioxygen (EXP,ISO) diquat (ISO) disodium selenite (EXP,ISO) diuron (EXP,ISO) divanadium pentaoxide (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) ethanol (ISO) folic acid (ISO) formaldehyde (EXP,ISO) fulvestrant (ISO) furan (EXP) furosemide (EXP) genistein (EXP,ISO) heparin (ISO) hydrogen peroxide (EXP,ISO) indometacin (EXP,ISO) inulin (ISO) iron dichloride (ISO) L-methionine (ISO) lead diacetate (EXP,ISO) lead(0) (EXP,ISO) leflunomide (EXP) lipopolysaccharide (ISO) lovastatin (EXP) maneb (ISO) masitinib (ISO) melatonin (ISO) methamphetamine (EXP) methylisothiazolinone (ISO) methylmercury chloride (ISO) microcystin-LR (ISO) mifepristone (EXP) monosodium L-glutamate (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) N-phosphocreatine (EXP) nitrofen (EXP) Nor-9-carboxy-delta9-THC (ISO) ochratoxin A (EXP) okadaic acid (ISO) oxybenzone (ISO) oxycodone (EXP) ozone (ISO) p-toluidine (EXP) panobinostat (ISO) paracetamol (ISO) paraquat (EXP,ISO) PCB138 (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) pioglitazone (ISO) pirinixic acid (EXP,ISO) ponatinib (ISO) potassium dichromate (ISO) progesterone (ISO) propanal (ISO) protein kinase inhibitor (ISO) quercetin (EXP) raloxifene (ISO) remdesivir (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (EXP,ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sorafenib (ISO) streptozocin (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (EXP) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vismodegib (ISO) vitamin E (ISO) vorinostat (ISO) zoledronic acid (ISO)
Biological Process
adrenal gland development (IEA,ISO) anatomical structure morphogenesis (IEA,ISO) animal organ morphogenesis (IEA,ISO) cardiac myofibril assembly (IEA,ISO,ISS) cell chemotaxis (IEA,ISO) cell migration (IBA,IEA,ISO) cell surface receptor protein tyrosine kinase signaling pathway (IBA,IEA) cellular response to amino acid stimulus (IEA,ISO) cellular response to fibroblast growth factor stimulus (IEP) cellular response to growth factor stimulus (IEA) cellular response to interleukin-1 (IEP) cellular response to reactive oxygen species (IEA,ISO) chemotaxis (IEA) embryonic cranial skeleton morphogenesis (IBA,IEA,ISO,ISS) embryonic digestive tract morphogenesis (IEA,ISO,ISS) embryonic skeletal system morphogenesis (ISS) estrogen metabolic process (IEA,ISO) extracellular matrix organization (IEA,ISO) face morphogenesis (IEA,ISO) female gonad development (IEA,ISO) hematopoietic progenitor cell differentiation (IEA,ISO) in utero embryonic development (IEA,ISO) inner ear development (IEP) Leydig cell differentiation (IEA,ISO) lung development (IEA,ISO) lung growth (IMP) luteinization (IEA,ISO,ISS) male genitalia development (IEA,ISO) male gonad development (IEP) metanephric glomerular capillary formation (IEA,ISO,ISS) negative regulation of platelet activation (IEA,ISO,ISS) odontogenesis of dentin-containing tooth (IEA,ISO) peptidyl-tyrosine phosphorylation (ISO) platelet aggregation (IEA,ISO,ISS) platelet-derived growth factor receptor signaling pathway (IEA,ISO,ISS) platelet-derived growth factor receptor-alpha signaling pathway (IEA,ISO) positive regulation of branching involved in lung morphogenesis (IMP) positive regulation of calcium-mediated signaling (IEA,ISO,ISS) positive regulation of cell migration (IEA,ISO,ISS) positive regulation of cell population proliferation (IBA,IEA,IMP,ISO,ISS) positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway (IEA,ISO) positive regulation of chemotaxis (IEA,ISO) positive regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS) positive regulation of fibroblast proliferation (IEA,ISO,ISS) positive regulation of peptidyl-tyrosine phosphorylation (IDA) protein autophosphorylation (ISO) regulation of mesenchymal stem cell differentiation (IEA,ISO,ISS) response to cytokine (IEP) response to estradiol (IEP) response to estrogen (IEP) response to formaldehyde (IEP) response to hormone (IEP) response to hyperoxia (IEP) retina vasculature development in camera-type eye (IEA,ISO,ISS) roof of mouth development (IEA,ISO) signal transduction involved in regulation of gene expression (IEA,ISO) skeletal system morphogenesis (IEA,ISO) white fat cell differentiation (IEA,ISO) wound healing (IEA,ISO)
Cellular Component
axon (IDA) cell junction (IEA,ISO) cell projection (IEA) cell surface (IEA,ISO) cilium (IEA,ISO,ISS) cytoplasm (IDA,IEA,ISO) cytosol (IEA,ISO) external side of plasma membrane (IEA,ISO) Golgi apparatus (IEA,ISO,ISS) membrane (IEA) microvillus (IEA,ISO) nuclear body (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IDA,IEA,ISO) plasma membrane (IBA,IDA,IEA,ISO,ISS) platelet-derived growth factor receptor-ligand complex (IEA,ISO) protein-containing complex (IEA,ISO) receptor complex (IBA)
Molecular Function
ATP binding (IEA) kinase activity (IEA) metal ion binding (IEA) nucleotide binding (IEA) phosphatidylinositol 3-kinase binding (IPI) phospholipase C activator activity (IEA,ISO) platelet-derived growth factor alpha-receptor activity (IBA,IDA,IEA,ISO) platelet-derived growth factor binding (IBA,IEA,ISO) platelet-derived growth factor receptor binding (IEA,ISO) protein binding (ISO) protein homodimerization activity (IEA,ISO,ISS) protein kinase activity (IEA,ISO) protein tyrosine kinase activity (IEA) protein-containing complex binding (IEA,ISO) transferase activity (IEA) transmembrane receptor protein tyrosine kinase activity (IEA,ISO) vascular endothelial growth factor binding (IEA,ISO) vascular endothelial growth factor receptor activity (IEA,ISO,ISS)
1.
Transgenic expression of osteoactivin in the liver attenuates hepatic fibrosis in rats.
Abe H, etal., Biochem Biophys Res Commun. 2007 May 11;356(3):610-5. Epub 2007 Mar 15.
2.
Stimulated activation of platelet-derived growth factor receptor in vivo in balloon-injured arteries: a link between angiotensin II and intimal thickening.
Abe J, etal., Circulation. 1997 Sep 16;96(6):1906-13.
3.
PDGFR-alpha as a potential therapeutic target in uterine sarcomas.
Adams SF, etal., Gynecol Oncol. 2007 Mar;104(3):524-8. Epub 2006 Oct 17.
4.
Response to imatinib mesylate in patients with hypereosinophilic syndrome.
Arefi M, etal., Int J Hematol. 2012 Sep;96(3):320-6. doi: 10.1007/s12185-012-1141-7. Epub 2012 Jul 18.
5.
Nilotinib-mediated mucosal healing in a rat model of colitis.
Ataca P, etal., World J Gastroenterol. 2013 Oct 7;19(37):6237-44. doi: 10.3748/wjg.v19.i37.6237.
6.
Expression of platelet-derived growth factor-A (PDGF-A), PDGF-B, and PDGF receptor-alpha and -beta during human testicular development and disease.
Basciani S, etal., J Clin Endocrinol Metab. 2002 May;87(5):2310-9.
7.
Preclinical evaluation of radiation and perifosine in a genetically and histologically accurate model of brainstem glioma.
Becher OJ, etal., Cancer Res. 2010 Mar 15;70(6):2548-57. doi: 10.1158/0008-5472.CAN-09-2503. Epub 2010 Mar 2.
8.
PDGF- and insulin/IGF-1-specific distinct modes of class IA PI 3-kinase activation in normal rat retinas and RGC-5 retinal ganglion cells.
Biswas SK, etal., Invest Ophthalmol Vis Sci. 2008 Aug;49(8):3687-98. Epub 2008 Apr 17.
9.
Fibroblast growth factor-2 represses platelet-derived growth factor receptor-alpha (PDGFR-alpha) transcription via ERK1/2-dependent Sp1 phosphorylation and an atypical cis-acting element in the proximal PDGFR-alpha promoter.
Bonello MR and Khachigian LM, J Biol Chem. 2004 Jan 23;279(4):2377-82. Epub 2003 Oct 30.
10.
Induction of PDGF receptor-alpha in rat myofibroblasts during pulmonary fibrogenesis in vivo.
Bonner JC, etal., Am J Physiol. 1998 Jan;274(1 Pt 1):L72-80.
11.
Expression patterns of PDGF-A, -B, -C and -D and the PDGF-receptors alpha and beta in activated rat hepatic stellate cells (HSC).
Breitkopf K, etal., Cytokine. 2005 Sep 7;31(5):349-57.
12.
[The expression of platelet-derived growth factor-A and its receptor in acute radiation-induced skin ulcer in rats]
Cao WH, etal., Zhonghua Shao Shang Za Zhi. 2005 Oct;21(5):359-62.
13.
Oligohydramnios decreases platelet-derived growth factor expression in fetal rat lungs.
Chen CM, etal., Neonatology. 2007;92(3):187-93. Epub 2007 May 21.
14.
Adenoviral gene transfer of PDGF downregulates gas gene product PDGFalphaR and prolongs ERK and Akt/PKB activation.
Chen QP and Giannobile WV, Am J Physiol Cell Physiol. 2002 Mar;282(3):C538-44.
15.
Temporal changes in gene expression following cryogenic rat brain injury.
Cook JL, etal., Brain Res Mol Brain Res. 1998 Mar 30;55(1):9-19.
16.
The EOL-1 cell line as an in vitro model for the study of FIP1L1-PDGFRA-positive chronic eosinophilic leukemia.
Cools J, etal., Blood. 2004 Apr 1;103(7):2802-5. Epub 2003 Nov 20.
17.
A tyrosine kinase created by fusion of the PDGFRA and FIP1L1 genes as a therapeutic target of imatinib in idiopathic hypereosinophilic syndrome.
Cools J, etal., N Engl J Med. 2003 Mar 27;348(13):1201-14.
18.
A high-potassium diet reduces infarct size and improves vascular structure in hypertensive rats.
Dorrance AM, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Jan;292(1):R415-22. Epub 2006 Aug 17.
19.
Induction of platelet-derived growth factor A and B chains and over-expression of their receptors in human pancreatic cancer.
Ebert M, etal., Int J Cancer. 1995 Sep 4;62(5):529-35.
20.
Novel imatinib-sensitive PDGFRA-activating point mutations in hypereosinophilic syndrome induce growth factor independence and leukemia-like disease.
Elling C, etal., Blood. 2011 Mar 10;117(10):2935-43. doi: 10.1182/blood-2010-05-286757. Epub 2011 Jan 11.
21.
Thyroid hormone administration enhances remyelination in chronic demyelinating inflammatory disease.
Fernandez M, etal., Proc Natl Acad Sci U S A. 2004 Nov 16;101(46):16363-8. Epub 2004 Nov 8.
22.
Immunohistochemistry analysis of platelet-derived growth factor A and B chains and platelet-derived growth factor alpha and beta receptor expression in benign prostatic hyperplasias and Gleason-graded human prostate adenocarcinomas.
Fudge K, etal., Mod Pathol. 1994 Jun;7(5):549-54.
23.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
24.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
25.
Expression and prognostic significance of platelet-derived growth factor and its receptors in epithelial ovarian neoplasms.
Henriksen R, etal., Cancer Res. 1993 Oct 1;53(19):4550-4.
26.
Conservation in sequence and affinity of human and rodent PDGF ligands and receptors.
Herren B, etal., Biochim Biophys Acta 1993 Jun 25;1173(3):294-302.
27.
Inhibition of platelet-derived growth factor receptor phosphorylation by STI571 (Gleevec) reduces growth and metastasis of human pancreatic carcinoma in an orthotopic nude mouse model.
Hwang RF, etal., Clin Cancer Res. 2003 Dec 15;9(17):6534-44.
28.
IL-13 and IL-1beta promote lung fibroblast growth through coordinated up-regulation of PDGF-AA and PDGF-Ralpha.
Ingram JL, etal., FASEB J. 2004 Jul;18(10):1132-4. Epub 2004 May 20.
29.
A role for platelet-derived growth factor beta-receptor in a newborn rat model of endothelin-mediated pulmonary vascular remodeling.
Jankov RP, etal., Am J Physiol Lung Cell Mol Physiol. 2005 Jun;288(6):L1162-70. Epub 2005 Feb 18.
30.
Autocrine PDGFR signaling promotes mammary cancer metastasis.
Jechlinger M, etal., J Clin Invest. 2006 Jun;116(6):1561-70.
31.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
32.
Isolation and characterization of the alpha platelet-derived growth factor receptor from rat olfactory epithelium.
Lee KH, etal., Mol Cell Biol 1990 May;10(5):2237-46.
33.
Identification of formaldehyde-responsive genes by suppression subtractive hybridization.
Lee MH, etal., Toxicology. 2008 Jan 14;243(1-2):224-35. Epub 2007 Oct 22.
34.
Expression of platelet-derived growth factor in the developing cochlea of rats.
Lee YW, etal., Acta Otolaryngol. 2004 Jun;124(5):558-62.
35.
Interleukin 1 beta (IL-1 beta) and the IL-1 beta-alpha 2-macroglobulin complex upregulate the platelet-derived growth factor alpha-receptor on rat pulmonary fibroblasts.
Lindroos PM, etal., Am J Respir Cell Mol Biol. 1995 Oct;13(4):455-65.
36.
Autoantigen-pulsed dendritic cells constitute a beneficial cytokine and growth factor network in ameliorating experimental allergic encephalomyelitis.
Liu X, etal., Mult Scler. 2005 Aug;11(4):381-9.
37.
Single-walled carbon nanotube (SWCNT)-induced interstitial fibrosis in the lungs of rats is associated with increased levels of PDGF mRNA and the formation of unique intercellular carbon structures that bridge alveolar macrophages in situ.
Mangum JB, etal., Part Fibre Toxicol. 2006 Nov 29;3:15.
38.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
39.
PDGF-alpha receptor expression following hypoxic-ischemic injury in the neonatal rat brain.
Morioka I, etal., Kobe J Med Sci. 2004 Jan;50(1-2):21-30.
40.
Aberrant platelet-derived growth factor alpha-receptor transcript as a diagnostic marker for early human germ cell tumors of the adult testis.
Mosselman S, etal., Proc Natl Acad Sci U S A. 1996 Apr 2;93(7):2884-8.
41.
Role of PDGF B-chain and PDGF receptors in rat tubular regeneration after acute injury.
Nakagawa T, etal., Am J Pathol. 1999 Nov;155(5):1689-99.
42.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
43.
Co-localization of NG2 proteoglycan and PDGF alpha-receptor on O2A progenitor cells in the developing rat brain.
Nishiyama A, etal., J Neurosci Res. 1996 Feb 1;43(3):299-314.
44.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
45.
Expression of the PDGF alpha-receptor 1.5 kb transcript, OCT-4, and c-KIT in human normal and malignant tissues. Implications for the early diagnosis of testicular germ cell tumours and for our understanding of regulatory mechanisms.
Palumbo C, etal., J Pathol. 2002 Apr;196(4):467-77.
46.
FIP1L1-PDGFRA fusion: prevalence and clinicopathologic correlates in 89 consecutive patients with moderate to severe eosinophilia.
Pardanani A, etal., Blood. 2004 Nov 15;104(10):3038-45. Epub 2004 Jul 29.
47.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
48.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
49.
[Characteristics of cytogenetics and molecular biology in patients with eosinophilia].
Qu SQ, etal., Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2012 Oct;20(5):1216-20.
50.
GOA pipeline
RGD automated data pipeline
51.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
52.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
53.
Comprehensive gene review and curation
RGD comprehensive gene curation
54.
Effect of platelet-derived growth factor isoforms in rat metanephric mesenchymal cells.
Ricono JM, etal., Am J Physiol Renal Physiol. 2002 Feb;282(2):F211-9.
55.
Effects of hypertension and aging on platelet-derived growth factor and platelet-derived growth factor receptor expression in rat aorta and heart.
Sarzani R, etal., Hypertension. 1991 Nov;18(5 Suppl):III93-9.
56.
The effect of acute rejection and cyclosporin A-treatment on induction of platelet-derived growth factor and its receptors during the development of chronic rat renal allograft rejection.
Savikko J, etal., Transplantation. 2002 Feb 27;73(4):506-11.
57.
Estrogen regulates insulin-like growth factor 1, platelet-derived growth factor A and B, and their receptors in the vascular wall.
Savolainen-Peltonen H, etal., Transplantation. 2004 Jan 15;77(1):35-42.
58.
Different roles for PDGF-alpha and -beta receptors in embryonic lung development.
Souza P, etal., Am J Respir Cell Mol Biol. 1996 Oct;15(4):551-62.
59.
Expression of platelet-derived growth factor-alpha alpha receptor is associated with tumor progression in clear cell renal cell carcinoma.
Sulzbacher I, etal., Am J Clin Pathol. 2003 Jul;120(1):107-12.
60.
Expression of angiogenic factors in craniopharyngiomas: implications for tumor recurrence.
Sun HI, etal., Neurosurgery. 2010 Apr;66(4):744-50; discussion 750. doi: 10.1227/01.NEU.0000367553.65099.14.
61.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
62.
Hes1 upregulation contributes to the development of FIP1L1-PDGRA-positive leukemia in blast crisis.
Uchida T, etal., Exp Hematol. 2014 May;42(5):369-379.e3. doi: 10.1016/j.exphem.2014.01.009. Epub 2014 Jan 31.
63.
Inhibition of platelet-derived growth factor actions in the embryonic testis influences normal cord development and morphology.
Uzumcu M, etal., Biol Reprod. 2002 Mar;66(3):745-53.
64.
A microRNA-1280/JAG2 network comprises a novel biological target in high-risk medulloblastoma.
Wang F, etal., Oncotarget. 2015 Feb 20;6(5):2709-24. doi: 10.18632/oncotarget.2779.
65.
Content and activity of cAMP response element-binding protein regulate platelet-derived growth factor receptor-alpha content in vascular smooth muscles.
Watson PA, etal., Endocrinology 2002 Aug;143(8):2922-9.
66.
Nilotinib and imatinib are comparably effective in reducing growth of human eosinophil leukemia cells in a newly established xenograft model.
Wicklein D, etal., PLoS One. 2012;7(2):e30567. doi: 10.1371/journal.pone.0030567. Epub 2012 Feb 14.
67.
Expression and mutational analysis of tyrosine kinase receptors c-kit, PDGFRalpha, and PDGFRbeta in ovarian cancers.
Wilczynski SP, etal., Hum Pathol. 2005 Mar;36(3):242-9.
68.
Cyclin-dependent kinase 7/9 inhibitor SNS-032 abrogates FIP1-like-1 platelet-derived growth factor receptor alpha and bcr-abl oncogene addiction in malignant hematologic cells.
Wu Y, etal., Clin Cancer Res. 2012 Apr 1;18(7):1966-78. doi: 10.1158/1078-0432.CCR-11-1971. Epub 2012 Mar 23.
69.
Activation of MAP kinases, Akt and PDGF receptors in injured peripheral nerves.
Yamazaki T, etal., J Peripher Nerv Syst. 2009 Sep;14(3):165-76. doi: 10.1111/j.1529-8027.2009.00228.x.
70.
Cyclooxygenase-2 overexpression inhibits platelet-derived growth factor-induced mesangial cell proliferation through induction of the tumor suppressor gene p53 and the cyclin-dependent kinase inhibitors p21waf-1/cip-1 and p27kip-1.
Zahner G, etal., J Biol Chem 2002 Mar 22;277(12):9763-71.
71.
Integrated Analysis of Multiple Microarray Studies to Identify Core Gene-Expression Signatures Involved in Tubulointerstitial Injury in Diabetic Nephropathy.
Zhou H, etal., Biomed Res Int. 2022 May 10;2022:9554658. doi: 10.1155/2022/9554658. eCollection 2022.
Pdgfra Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 33,360,027 - 33,408,604 (-) NCBI GRCr8 mRatBN7.2 14 33,005,838 - 33,054,347 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 33,005,839 - 33,054,335 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 33,356,581 - 33,405,000 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 34,664,393 - 34,712,811 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 33,149,650 - 33,198,062 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 35,527,926 - 35,581,130 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 35,527,927 - 35,581,031 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 35,356,434 - 35,409,311 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 35,369,422 - 35,418,126 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 35,369,672 - 35,418,126 (-) NCBI Celera 14 32,273,077 - 32,324,887 (-) NCBI Celera RH 3.4 Map 14 432.47 RGD Cytogenetic Map 14 p11 NCBI
PDGFRA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 54,229,293 - 54,298,245 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 54,229,280 - 54,298,245 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 55,095,460 - 55,164,412 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 54,790,204 - 54,859,169 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 54,936,129 - 55,005,339 NCBI Celera 4 52,596,023 - 52,665,170 (+) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 51,043,324 - 51,112,555 (+) NCBI HuRef CHM1_1 4 55,130,846 - 55,199,987 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 57,718,046 - 57,786,996 (+) NCBI T2T-CHM13v2.0
Pdgfra Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 75,311,988 - 75,358,867 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 75,312,953 - 75,358,876 (+) Ensembl GRCm39 Ensembl GRCm38 5 75,151,322 - 75,198,206 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 75,152,292 - 75,198,215 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 75,548,316 - 75,594,229 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 75,434,045 - 75,479,893 (+) NCBI MGSCv36 mm8 Celera 5 72,441,591 - 72,487,596 (+) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 39.55 NCBI
Pdgfra Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 16,569,909 - 16,612,373 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 16,570,652 - 16,613,410 (-) NCBI ChiLan1.0 ChiLan1.0
PDGFRA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 75,493,805 - 75,564,589 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 75,697,777 - 75,768,556 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 69,639,081 - 69,709,870 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 76,200,871 - 76,271,105 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 76,199,382 - 76,271,097 (-) Ensembl panpan1.1 panPan2
PDGFRA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 46,729,722 - 46,775,828 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 46,730,703 - 46,773,278 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 46,687,151 - 46,733,378 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 47,339,954 - 47,386,179 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 47,340,084 - 47,386,176 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 47,012,519 - 47,058,684 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 46,544,815 - 46,590,877 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 47,418,193 - 47,464,247 (+) NCBI UU_Cfam_GSD_1.0
Pdgfra Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 29,444,794 - 29,494,171 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 16,807,569 - 16,853,587 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 16,804,129 - 16,853,539 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PDGFRA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 40,967,493 - 41,021,441 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 40,966,568 - 41,021,440 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 43,067,784 - 43,081,654 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PDGFRA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 14,243,291 - 14,307,373 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 14,241,070 - 14,307,422 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666066 15,086,695 - 15,149,115 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdgfra
.
Predicted Target Of
Count of predictions: 518 Count of miRNA genes: 252 Interacting mature miRNAs: 331 Transcripts: ENSRNOT00000003077 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 2324617 Coatc2 Coat color QTL 2 0.001 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 14 30767025 39153750 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
D14Wox20
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 33,055,829 - 33,056,013 (+) MAPPER mRatBN7.2 Rnor_6.0 14 35,582,526 - 35,582,709 NCBI Rnor6.0 Rnor_5.0 14 35,410,806 - 35,410,989 UniSTS Rnor5.0 RGSC_v3.4 14 35,419,622 - 35,419,807 UniSTS RGSC3.4 Celera 14 32,326,366 - 32,326,549 UniSTS Cytogenetic Map 14 p11 UniSTS
RH94451
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 33,006,129 - 33,006,285 (+) MAPPER mRatBN7.2 Rnor_6.0 14 35,528,218 - 35,528,373 NCBI Rnor6.0 Rnor_5.0 14 35,356,726 - 35,356,881 UniSTS Rnor5.0 RGSC_v3.4 14 35,369,714 - 35,369,869 UniSTS RGSC3.4 RH 3.4 Map 14 432.47 UniSTS Cytogenetic Map 14 p11 UniSTS
M84607
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 33,008,692 - 33,008,866 (+) MAPPER mRatBN7.2 Rnor_6.0 14 35,530,781 - 35,530,954 NCBI Rnor6.0 Rnor_5.0 14 35,359,289 - 35,359,462 UniSTS Rnor5.0 RGSC_v3.4 14 35,372,277 - 35,372,450 UniSTS RGSC3.4 Celera 14 32,279,520 - 32,279,693 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003077 ⟹ ENSRNOP00000003077
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 33,005,839 - 33,054,335 (-) Ensembl Rnor_6.0 Ensembl 14 35,527,927 - 35,581,031 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118506 ⟹ ENSRNOP00000081799
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 33,005,839 - 33,044,103 (-) Ensembl
RefSeq Acc Id:
NM_012802 ⟹ NP_036934
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,408,516 (-) NCBI mRatBN7.2 14 33,005,838 - 33,054,335 (-) NCBI Rnor_6.0 14 35,527,926 - 35,581,031 (-) NCBI Rnor_5.0 14 35,356,434 - 35,409,311 (-) NCBI RGSC_v3.4 14 35,369,422 - 35,418,126 (-) RGD Celera 14 32,273,077 - 32,324,887 (-) RGD
Sequence:
ACTGTTGGAGCTTGAGGGAGTGAAACAAACAGAGGAACTGTGGGCGAGGACTGGAGGCTTGGGGCTCACTTTTTCCTCCGGGCTATCGGATTTTCTTAGCAAACTGACGTAGGAGGAGAAGTTCTCAG
hide sequence
RefSeq Acc Id:
XM_006250879 ⟹ XP_006250941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,405,234 (-) NCBI mRatBN7.2 14 33,005,838 - 33,051,026 (-) NCBI Rnor_6.0 14 35,527,926 - 35,577,277 (-) NCBI Rnor_5.0 14 35,356,434 - 35,409,311 (-) NCBI
Sequence:
CGCAGATAGACAGGCAGACAGATAGACAGACACAGTCACAGACACAGACACAGAGAGACACCCA
hide sequence
RefSeq Acc Id:
XM_006250880 ⟹ XP_006250942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,408,604 (-) NCBI mRatBN7.2 14 33,005,838 - 33,054,347 (-) NCBI Rnor_6.0 14 35,527,926 - 35,581,130 (-) NCBI Rnor_5.0 14 35,356,434 - 35,409,311 (-) NCBI
Sequence:
TTCATTTCCTGACAGCTATTTACTTTGAGCAAATGATTAGTTTTCGGAGGATGGACTATAACATTGAATCAATTACAAAATGCGGGTTTTGAGCCCATTACTGTTGGAGCTTGAGGGAGTGAAACAAA
hide sequence
RefSeq Acc Id:
XM_006250881 ⟹ XP_006250943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,405,792 (-) NCBI mRatBN7.2 14 33,005,838 - 33,051,604 (-) NCBI Rnor_6.0 14 35,527,926 - 35,578,317 (-) NCBI Rnor_5.0 14 35,356,434 - 35,409,311 (-) NCBI
Sequence:
GAGGCGGGCGGGCGGGATTTCTGCCTCCTGGGGACAGGACCTAGGCTGCGCGCGACCTGGGGACGTGGTGACCAGCCTTCTGCCTGCTGACCTCGAAGGGTGGGAACCCCTCTGGCCTTCATTCTCAG
hide sequence
RefSeq Acc Id:
XM_039091625 ⟹ XP_038947553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,405,717 (-) NCBI mRatBN7.2 14 33,005,838 - 33,051,284 (-) NCBI
RefSeq Acc Id:
XM_039091626 ⟹ XP_038947554
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,407,493 (-) NCBI mRatBN7.2 14 33,005,838 - 33,053,311 (-) NCBI
RefSeq Acc Id:
XM_039091627 ⟹ XP_038947555
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,360,027 - 33,405,572 (-) NCBI mRatBN7.2 14 33,005,838 - 33,051,386 (-) NCBI
RefSeq Acc Id:
NP_036934 ⟸ NM_012802
- Peptide Label:
precursor
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot), G3V6A0 (UniProtKB/TrEMBL), A6JD04 (UniProtKB/TrEMBL)
- Sequence:
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYVPDPDMAFV
hide sequence
RefSeq Acc Id:
XP_006250942 ⟸ XM_006250880
- Peptide Label:
isoform X2
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot), G3V6A0 (UniProtKB/TrEMBL), A6JD04 (UniProtKB/TrEMBL)
- Sequence:
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEE
hide sequence
RefSeq Acc Id:
XP_006250943 ⟸ XM_006250881
- Peptide Label:
isoform X2
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot), G3V6A0 (UniProtKB/TrEMBL), A6JD04 (UniProtKB/TrEMBL)
- Sequence:
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYVPDPDMAFV
hide sequence
RefSeq Acc Id:
XP_006250941 ⟸ XM_006250879
- Peptide Label:
isoform X2
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot), G3V6A0 (UniProtKB/TrEMBL), A6JD04 (UniProtKB/TrEMBL)
- Sequence:
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEE
hide sequence
Ensembl Acc Id:
ENSRNOP00000003077 ⟸ ENSRNOT00000003077
RefSeq Acc Id:
XP_038947554 ⟸ XM_039091626
- Peptide Label:
isoform X2
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot), G3V6A0 (UniProtKB/TrEMBL), A6JD04 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038947555 ⟸ XM_039091627
- Peptide Label:
isoform X2
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot), G3V6A0 (UniProtKB/TrEMBL), A6JD04 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038947553 ⟸ XM_039091625
- Peptide Label:
isoform X1
- UniProtKB:
P20786 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000081799 ⟸ ENSRNOT00000118506
RGD ID: 13699281 Promoter ID: EPDNEW_R9806 Type: initiation region Name: Pdgfra_1 Description: platelet derived growth factor receptor alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 35,581,034 - 35,581,094 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Pdgfra
platelet derived growth factor receptor alpha
LOC102554024
platelet-derived growth factor receptor alpha-like
Data merged from RGD:7573251
737654 PROVISIONAL
2016-01-25
Pdgfra
platelet derived growth factor receptor alpha
Pdgfra
platelet derived growth factor receptor, alpha polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-12-18
LOC102554024
platelet-derived growth factor receptor alpha-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Pdgfra
Platelet-derived growth factor receptor alpha
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_regulation
mRNA expression decreased by the transcription factor cAMP response element-binding protein (CREB) in vascular smooth muscle cells (SMCs)
625715
