Ugt1a5 (UDP glucuronosyltransferase family 1 member A5)

Advanced Search (OLGA)

Gene: Ugt1a5 (UDP glucuronosyltransferase family 1 member A5) Rattus norvegicus

Analyze

Symbol:

Ugt1a5 (Ensembl: Ugt1a8)

Name:

UDP glucuronosyltransferase family 1 member A5 (Ensembl:UDP glucuronosyltransferase family 1 member A8)

RGD ID:

1583689

Description:

Predicted to enable enzyme binding activity; glucuronosyltransferase activity; and protein dimerization activity. Involved in cellular response to ethanol; cellular response to glucocorticoid stimulus; and liver development. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in endoplasmic reticulum. Orthologous to human UGT1A4 (UDP glucuronosyltransferase family 1 member A4); PARTICIPATES IN nicotine pharmacodynamics pathway; nicotine pharmacokinetics pathway; phenytoin pharmacodynamics pathway; INTERACTS WITH (-)-cotinine (ortholog); (5Z,8Z,11Z,13E)-15-HETE (ortholog); (S)-nicotine (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

B5; UDP glucuronosyltransferase 1 family, polypeptide A5; UDP glycosyltransferase 1 family, polypeptide A5; UDP-glucuronosyltransferase 1-5; UDP-glucuronosyltransferase 1A5; UDPGT; UDPGT 1-5; Ugt1; UGT1*5; UGT1-05; UGT1.5; Ugt1a6

RGD Orthologs

Human

Mouse

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UGT1A4 (UDP glucuronosyltransferase family 1 member A4)	HGNC	HomoloGene
Mus musculus (house mouse):	Ugt1a5 (UDP glucuronosyltransferase 1 family, polypeptide A5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	UGT1A5 (UDP glucuronosyltransferase family 1 member A5)	HGNC	Panther
Homo sapiens (human):	UGT1A3 (UDP glucuronosyltransferase family 1 member A3)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	UGT1A4 (UDP glucuronosyltransferase family 1 member A4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ugt1a5 (UDP glucuronosyltransferase 1 family, polypeptide A5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ugt1a7 (UDP glucuronosyltransferase 1 family, polypeptide A7)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ugt1ab (UDP glucuronosyltransferase 1 family a, b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10168	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10170	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG10178	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ugt-22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Caenorhabditis elegans (roundworm):	ugt-26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG16732	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	ugt-62	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17323	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG31002	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATG26	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	Ugt37c1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt35b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86Dc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86De	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86Dg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt86Dj	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dot	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt86Dh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5724	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG5999	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt37b1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt36Bb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG3797	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt35a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ugt36Ba	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt36Bc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder)
Drosophila melanogaster (fruit fly):	Ugt86Da	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ugt1a1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	96,210,053 - 96,256,264 (+)	NCBI		GRCr8
mRatBN7.2	9	88,762,250 - 88,808,465 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,713,184 - 88,808,465 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	97,186,086 - 97,232,360 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,322,282 - 102,368,552 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,690,441 - 100,736,659 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	95,256,628 - 95,302,822 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	95,161,157 - 95,302,822 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,943,844 - 94,990,037 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	87,052,169 - 87,098,362 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	86,323,550 - 86,369,556 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bilirubin metabolic disorder (ISO)

celiac disease (ISO)

Crigler Najjar Syndrome, Type 2 (ISO)

Crigler-Najjar syndrome (ISO)

genetic disease (ISO)

Gilbert syndrome (ISO)

Hyperbilirubinemia, Transient Familial Neonatal (ISO)

Joubert syndrome 22 (ISO)

Perlman syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-cotinine (ISO)

(5Z,8Z,11Z,13E)-15-HETE (ISO)

(S)-nicotine (ISO)

1-Hydroxypyrene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

20-HETE (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-hydroxyphenytoin (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

Afloqualone (ISO)

amentoflavone (ISO)

amphibole asbestos (ISO)

androsterone (ISO)

arachidonic acid (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

betulin (ISO)

biphenyl-4-amine (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butyric acid (ISO)

captan (ISO)

clofibrate (ISO)

clozapine (ISO)

dibenzo[a,l]pyrene (ISO)

dichloroacetic acid (ISO)

diclofenac (ISO)

dimethylarsinic acid (ISO)

ethanol (ISO)

ethoxyquin (ISO)

farnesol (ISO)

fenthion (ISO)

finasteride (ISO)

flurbiprofen (ISO)

folpet (ISO)

Hecogenin (ISO)

imipramine (ISO)

indometacin (ISO)

inulin (ISO)

ketoprofen (ISO)

lamotrigine (ISO)

Licochalcone A (ISO)

lipopolysaccharide (ISO)

methotrexate (ISO)

methylarsonic acid (ISO)

morphine (ISO)

N'-Nitrosoanabasine (ISO)

N'-Nitrosoanatabine (ISO)

N'-Nitrosonornicotine (ISO)

N-hydroxy-PhIP (ISO)

N-Nitrosopyrrolidine (ISO)

nicotine (ISO)

Nor-9-carboxy-delta9-THC (ISO)

obeticholic acid (ISO)

oltipraz (ISO)

omeprazole (ISO)

perfluorodecanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

sarpogrelate (ISO)

senecionine (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

spironolactone (ISO)

sulindac (ISO)

sulindac sulfone (ISO)

tamoxifen (ISO)

triclocarban (ISO)

triclosan (ISO)

trifluoperazine (ISO)

Triptolide (ISO)

troglitazone (ISO)

ursodeoxycholic acid (ISO)

usnic acid (ISO)

valproic acid (ISO)

zinc molecular entity (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular glucuronidation (IBA,ISO)

cellular response to ethanol (IEP)

cellular response to glucocorticoid stimulus (IEP)

cellular response to hormone stimulus (IEP)

liver development (IEP)

response to organic cyclic compound (IEP)

vitamin D3 metabolic process (ISO)

Cellular Component

endoplasmic reticulum (IBA,ISO)

endoplasmic reticulum membrane (IEA)

Molecular Function

enzyme binding (IBA,ISO)

glucuronosyltransferase activity (IEA,ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

retinoic acid binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ascorbate and aldarate metabolic pathway (IEA)

nicotine pharmacodynamics pathway (ISO)

nicotine pharmacokinetics pathway (ISO)

O-linked glycan biosynthetic pathway (IEA)

pentose and glucuronate interconversion pathway (IEA)

phase I biotransformation pathway via cytochrome P450 (IEA)

phenytoin pharmacodynamics pathway (ISO)

porphyrin and chlorophyll metabolic pathway (IEA)

retinol metabolic pathway (IEA)

starch and sucrose metabolic pathway (IEA)

steroid hormone biosynthetic pathway (IEA)

tamoxifen pharmacodynamics pathway (ISO)

tamoxifen pharmacokinetics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Ontogenic isoform switching of UDP-glucuronosyltransferase family 1 in rat liver.	Kishi M, etal., Biochem Biophys Res Commun. 2008 Dec 19;377(3):815-9. Epub 2008 Oct 18.
3.	Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology	Li Y, etal., Zhonghua Gan Zang Bing Za Zhi. 2001 Jun;9(3):172-4.
4.	The effect of hormones on the expression of five isoforms of UDP-glucuronosyltransferase in primary cultures of rat hepatocytes.	Li YQ, etal., Pharm Res. 1999 Feb;16(2):191-7.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Increase in rat liver UDP-glucuronosyltransferase mRNA by microsomal enzyme inducers that enhance thyroid hormone glucuronidation.	Vansell NR and Klaassen CD, Drug Metab Dispos. 2002 Mar;30(3):240-6.

Additional References at PubMed

PMID:1748678	PMID:1898728	PMID:2112380	PMID:7608130	PMID:11854153	PMID:14672974	PMID:16141793	PMID:17179145	PMID:20308471	PMID:20610558	PMID:22579593

Genomics

Comparative Map Data

Ugt1a5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	96,210,053 - 96,256,264 (+)	NCBI		GRCr8
mRatBN7.2	9	88,762,250 - 88,808,465 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,713,184 - 88,808,465 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	97,186,086 - 97,232,360 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,322,282 - 102,368,552 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,690,441 - 100,736,659 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	95,256,628 - 95,302,822 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	95,161,157 - 95,302,822 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,943,844 - 94,990,037 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	87,052,169 - 87,098,362 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	86,323,550 - 86,369,556 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

UGT1A4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	233,718,736 - 233,773,300 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	233,718,736 - 233,773,300 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	234,627,382 - 234,681,946 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	234,292,177 - 234,346,684 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	234,409,437 - 234,463,945	NCBI
Celera	2	228,348,057 - 228,402,577 (+)	NCBI		Celera
Cytogenetic Map	2	q37.1	NCBI
HuRef	2	226,427,432 - 226,481,779 (+)	NCBI		HuRef
CHM1_1	2	234,633,252 - 234,682,899 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	234,207,385 - 234,261,929 (+)	NCBI		T2T-CHM13v2.0

Ugt1a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	88,093,734 - 88,147,724 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	88,093,734 - 88,146,719 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	88,166,012 - 88,220,002 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	88,166,012 - 88,218,997 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	90,062,587 - 90,116,577 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	89,997,183 - 90,050,148 (+)	NCBI		MGSCv36	mm8
Celera	1	91,126,155 - 91,181,062 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	44.53	NCBI

Variants

Variants in Ugt1a5
258 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	79271511	91616855	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	86369631	92058970	Rat

Markers in Region

D9Mco15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	88,786,718 - 88,787,007 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	95,281,097 - 95,281,383	NCBI	Rnor6.0
Rnor_5.0	9	94,968,312 - 94,968,598	UniSTS	Rnor5.0
RGSC_v3.4	9	87,076,637 - 87,076,923	UniSTS	RGSC3.4
Celera	9	86,348,016 - 86,348,299	UniSTS
Cytogenetic Map	9	q35	UniSTS

D9Wox40

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	88,786,755 - 88,786,956 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	95,281,134 - 95,281,332	NCBI	Rnor6.0
Rnor_5.0	9	94,968,349 - 94,968,547	UniSTS	Rnor5.0
RGSC_v3.4	9	87,076,674 - 87,076,872	UniSTS	RGSC3.4
Celera	9	86,348,053 - 86,348,248	UniSTS
Cytogenetic Map	9	q35	UniSTS

RH130767

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	88,795,599 - 88,795,779 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	95,289,976 - 95,290,155	NCBI	Rnor6.0
Rnor_5.0	9	94,977,191 - 94,977,370	UniSTS	Rnor5.0
RGSC_v3.4	9	87,085,516 - 87,085,695	UniSTS	RGSC3.4
Celera	9	86,356,892 - 86,357,071	UniSTS
Cytogenetic Map	9	q35	UniSTS
Cytogenetic Map	9	q35-q36	UniSTS

RH94830

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	88,808,140 - 88,808,341 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	95,302,498 - 95,302,698	NCBI	Rnor6.0
Rnor_5.0	9	94,989,713 - 94,989,913	UniSTS	Rnor5.0
RGSC_v3.4	9	87,098,038 - 87,098,238	UniSTS	RGSC3.4
Celera	9	86,369,232 - 86,369,432	UniSTS
Cytogenetic Map	9	q35	UniSTS
Cytogenetic Map	9	q35-q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001039549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC092531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC120922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF461734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY435132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D38069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S70366	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

NM_001039549 ⟹ NP_001034638

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	96,210,053 - 96,256,264 (+)	NCBI
mRatBN7.2	9	88,762,250 - 88,808,465 (+)	NCBI
Rnor_6.0	9	95,256,628 - 95,302,822 (+)	NCBI
Rnor_5.0	9	94,943,844 - 94,990,037 (+)	NCBI
RGSC_v3.4	9	87,052,169 - 87,098,362 (+)	RGD
Celera	9	86,323,550 - 86,369,556 (+)	RGD

Sequence:

show sequence

GAAACCTGTTCTCGTGGGTGTCCACTGAAGTGACTATGGGACTCCATGTGACCCTGCAAGGATT
AGCTGGGCTGCTGCTGCTGCTGTATGCCCTGCCCTGGGCTGAAGGTGGAAAGGTGCTGGTGTTT
CCCATGGAGGGCAGCCACTGGCTGAGCATGAGGGATGTCGTGAGGGAGCTCCACGCCCGAGGTC
ACCAGGCTGTGGTCCTGGCTCCAGAGGTGACTGTGCACATCAAAGAAGAGGACTTCTTCACCCT
CCAAACCTACCCTGTTCCATACACAAGACAAGGATTTAGACAACAAATGATGCGAAACATTAAA
GTGGTCTTTGAAACAGGCAACTATGTGAAGACATTCCTTGAAACATCCGAGATTTTGAAAAACA
TATCGACAGTTCTCTTAAGGTCTTGTATGAATCTATTGCACAATGGGTCCCTGCTCCAGCATCT
GAATTCCAGCTCCTTTGACATGGTCTTAACAGATCCTGTGATTCCGTGTGGGGCAGTGCTGGCC
AAGTACTTGGGTATCCCCACTGTGTTCTTTCTACGATACATTCCCTGTGGCATAGACTCTGAGG
CCACACAATGTCCGAAACCTTCCTCTTATATTCCGAACCTACTCACAATGCTTTCTGACCACAT
GACTTTCCTGCAAAGGGTCAAGAACATGCTGTACCCTCTGGCCTTGAAGTACATTTGCCATTTC
TCATTCACTCGCTATGAAAGCCTGGCCTCTGAGCTTTTGCAGAGAGAAGTGTCTTTAGTGGAGG
TTCTCAGCCATGCATCTGTGTGGCTGTTCCGAGGGGACTTTGTGTTCGACTACCCGAGGCCTGT
CATGCCTAACATGGTCTTCATTGGAGGCATAAACTGTGTCATCAAGAAGCCTCTTTCTCAGGAA
TTTGAAGCCTATGTCAACGCCTCCGGAGAACATGGCATCGTGGTTTTCTCTTTGGGATCCATGG
TCTCAGAGATTCCAGAGAAGAAAGCGATGGAAATTGCTGAGGCTTTGGGCAGAATTCCTCAGAC
GGTCCTGTGGCGCTACACCGGAACTAGACCATCGAACCTTGCAAAGAACACTATTCTTGTCAAA
TGGCTACCCCAAAACGATCTGCTTGGTCATCCAAAGGCTCGGGCGTTCATCACACACTCCGGTT
CCCATGGTATTTATGAAGGAATATGCAATGGGGTTCCAATGGTGATGATGCCCTTGTTTGGTGA
TCAGATGGACAACGCCAAGCGCATGGAAACTCGGGGAGCTGGGGTGACCCTGAATGTCCTGGAA
ATGACTGCCGATGATTTGGAAAACGCCCTTAAAACTGTCATCAATAACAAGAGTTACAAGGAGA
ACATCATGCGCCTCTCCAGCCTTCACAAGGACCGTCCTATCGAGCCTCTGGACCTGGCTGTGTT
CTGGGTGGAGTACGTGATGAGGCACAAGGGGGCGCCACACCTGCGCCCCGCCGCCCACGACCTC
ACCTGGTACCAGTACCACTCCTTGGACGTGATTGGCTTTCTCCTGGCCATCGTGTTGACGGTGG
TCTTCATTGTCTATAAAAGTTGTGCCTATGGCTGCCGGAAATGCTTTGGGGGAAAGGGTCGAGT
GAAGAAATCACACAAATCCAAGACCCACTGAGAAGTGGCAGGAAGTGAAGGAGAAGTATTAGTC
CCTTATCCAATCAGTTGAAACTTGGAAACAAGTGTTAAATCCATGTTGCTTTTATTAGGGAAAT
AATTCACCATACACTATACACCCAGAACAATTTTTTTTCTTTTTCTTTTTTTCGGAGCTGGGGA
CCGAACCCAGAACATTTTTTTTTTTAAATAAAAACAATCTAATTGCTGGCCACACCCATCAGGG
AAGATACTGGAATATGTGATCTGTTTCTCCAGTATCTTCAGTCTGGACAATGACTGCCATCTGT
TGGTAACTTACAGAAAGTTTAGTGTTCTGCCTTCAGTGACAGCACCACAGTTTCCCTTACTCCT
GTCAGCTAATGGCTTCCTCCCCTGGATTCTCAGACCAGTGTGGCCTTCCCAGTGTTAGTCATTC
CTCACTGTGCTCATGTTTTGTGGGTGGCACGGCCTTTGAGCTTTGGGAGAAAAGAAGATGAGGC
TGTGACACTGGTGGCCCTGTGTTTGAGATAATAATTATTGCTTGTCTCTGAATTTGATGAAAAC
TGAAGTACATTCTAAAGAAAGTATGTCTTCTATTGTGTTCCCAAACCAAGAACTTGTCAATAAA
TTCATATAAATTGTATTATTACTTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001034638	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL67850	(Get FASTA)	NCBI Sequence Viewer
	AAR95633	(Get FASTA)	NCBI Sequence Viewer
	BAA07263	(Get FASTA)	NCBI Sequence Viewer
	EDL92106	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025292.6
	ENSRNOP00000063634.3
GenBank Protein	Q64638	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001034638 ⟸ NM_001039549
- Peptide Label:	precursor
- UniProtKB:	Q64638 (UniProtKB/Swiss-Prot), Q6T5F0 (UniProtKB/TrEMBL), F7ELD4 (UniProtKB/TrEMBL), A0A9K3Y841 (UniProtKB/TrEMBL), Q8VD45 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGLHVTLQGLAGLLLLLYALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAPEVTV HIKEEDFFTLQTYPVPYTRQGFRQQMMRNIKVVFETGNYVKTFLETSEILKNISTVLLRSCMNL LHNGSLLQHLNSSSFDMVLTDPVIPCGAVLAKYLGIPTVFFLRYIPCGIDSEATQCPKPSSYIP NLLTMLSDHMTFLQRVKNMLYPLALKYICHFSFTRYESLASELLQREVSLVEVLSHASVWLFRG DFVFDYPRPVMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEI AEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGV PMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDR PIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGC RKCFGGKGRVKKSHKSKTH hide sequence

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64638-F1-model_v2	AlphaFold	Q64638	1-531	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583689	AgrOrtholog
BioCyc Gene	G2FUF-26821	BioCyc
Ensembl Genes	ENSRNOG00000018740	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025291.8	UniProtKB/TrEMBL
	ENSRNOT00000066839.5	UniProtKB/TrEMBL
Gene3D-CATH	Glycogen Phosphorylase B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	UDP-glycosyltransferase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP_glucos_trans	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP_glycos_trans_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:574523	UniProtKB/TrEMBL
NCBI Gene	574523	ENTREZGENE
PANTHER	EG:EG0003.4 PROTEIN-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP GLUCURONOSYLTRANSFERASE 1 FAMILY POLYPEPTIDE A3 PRECURSOR-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	UDPGT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ugt1a5	PhenoGen
PROSITE	UDPGT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018740	RatGTEx
Superfamily-SCOP	UDP-Glycosyltransferase/glycogen phosphorylase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A9K3Y841	ENTREZGENE, UniProtKB/TrEMBL
	F7EKA4_RAT	UniProtKB/TrEMBL
	F7ELD4	ENTREZGENE
	Q64638	ENTREZGENE
	Q6T5F0	ENTREZGENE, UniProtKB/TrEMBL
	Q8VD45	ENTREZGENE, UniProtKB/TrEMBL
	UD15_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	F7ELD4	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Ugt1a5	UDP glucuronosyltransferase family 1 member A5	Ugt1a5	UDP glucuronosyltransferase 1 family, polypeptide A5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Ugt1a5	UDP glucuronosyltransferase 1 family, polypeptide A5	Ugt1a5	UDP glycosyltransferase 1 family, polypeptide A5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	Ugt1a5	UDP glycosyltransferase 1 family, polypeptide A5			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)