Advanced Search (OLGA)

Gene: Polr2l (RNA polymerase II, I and III subunit L) Rattus norvegicus

Analyze

Symbol:

Polr2l

Name:

RNA polymerase II, I and III subunit L

RGD ID:

1566209

Description:

Predicted to enable zinc ion binding activity. Predicted to be involved in transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of RNA polymerase I complex; RNA polymerase II, core complex; and RNA polymerase III complex. Orthologous to human POLR2L (RNA polymerase II, I and III subunit L); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase II transcription pathway; RNA polymerase III transcription pathway; INTERACTS WITH 3-chloropropane-1,2-diol; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DNA-directed RNA polymerases I, II, and III subunit RPABC5; DNA-directed RNA polymerases I, II, and III subunit RPABC5-like; hypothetical protein LOC502374; LOC100911840; LOC502374; polymerase (RNA) II (DNA directed) polypeptide L; polymerase (RNA) II subunit L; RNA polymerase II subunit L

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Polr2l-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	205,999,607 - 206,001,615 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	8,341,868 - 8,342,071 (-)	Ensembl				GRCr8
mRatBN7.2	1	196,570,051 - 196,572,060 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	8,335,702 - 8,335,905 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	204,915,412 - 204,917,413 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	212,043,912 - 212,045,918 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	204,718,062 - 204,720,068 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	214,451,966 - 214,453,974 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	1	220,932,289 - 220,934,297 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	201,659,267 - 201,661,275 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	194,203,547 - 194,205,555 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

glafenine (EXP)

hydralazine (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methidathion (ISO)

nitrates (ISO)

ozone (ISO)

phenobarbital (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloroethene (ISO)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA-templated transcription (IEA)

termination of RNA polymerase III transcription (ISO)

transcription by RNA polymerase I (IBA)

transcription by RNA polymerase II (IBA,ISO)

transcription by RNA polymerase III (ISO)

transcription elongation by RNA polymerase I (ISO)

transcription elongation by RNA polymerase II (ISO)

transcription initiation at RNA polymerase II promoter (ISO)

transcription initiation at RNA polymerase III promoter (ISO)

tRNA transcription by RNA polymerase III (IBA)

Cellular Component

DNA-directed RNA polymerase complex (IEA)

nucleoplasm (ISO)

nucleus (IEA,ISO)

RNA polymerase I complex (IBA,ISO)

RNA polymerase II, core complex (IBA,IEA,ISO)

RNA polymerase III complex (IBA,ISO)

Molecular Function

DNA binding (IEA)

DNA-directed RNA polymerase activity (IBA,IEA)

metal ion binding (IEA)

protein binding (ISO)

zinc ion binding (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Huntington's disease pathway (IEA)

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

RNA polymerase I transcription pathway (ISO)

RNA polymerase II transcription pathway (ISO)

RNA polymerase III transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:9268387	PMID:9852112

Genomics

Comparative Map Data

Polr2l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	205,999,607 - 206,001,615 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	8,341,868 - 8,342,071 (-)	Ensembl				GRCr8
mRatBN7.2	1	196,570,051 - 196,572,060 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	8,335,702 - 8,335,905 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	204,915,412 - 204,917,413 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	212,043,912 - 212,045,918 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	204,718,062 - 204,720,068 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	214,451,966 - 214,453,974 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	1	220,932,289 - 220,934,297 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	201,659,267 - 201,661,275 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	194,203,547 - 194,205,555 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

POLR2L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	839,721 - 842,529 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	837,356 - 842,561 (-)	Ensembl			hg38	GRCh38
GRCh37	11	839,721 - 842,529 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	829,721 - 832,529 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	829,721 - 832,529	NCBI
Celera	11	906,402 - 909,212 (-)	NCBI		Celera
Cytogenetic Map	11	p15.5	NCBI
HuRef	11	655,066 - 657,876 (-)	NCBI		HuRef
CHM1_1	11	838,762 - 841,571 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	891,096 - 893,906 (-)	NCBI		T2T-CHM13v2.0

Polr2l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	141,051,773 - 141,055,066 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	141,051,773 - 141,055,045 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	141,471,860 - 141,475,153 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	141,471,860 - 141,475,132 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	148,657,759 - 148,661,052 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	141,323,179 - 141,326,505 (-)	NCBI		MGSCv36	mm8
Celera	7	141,265,651 - 141,268,944 (-)	NCBI		Celera
Cytogenetic Map	7	F5	NCBI
cM Map	7	86.83	NCBI

Polr2l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955476	11,291,215 - 11,293,536 (+)	Ensembl
ChiLan1.0	NW_004955476	11,291,215 - 11,293,536 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC112440089
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	45,701,850 - 45,704,003 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	41,665,421 - 41,665,982 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	30,886,703 - 30,887,284 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	31,751,398 - 31,752,309 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

POLR2L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	45,201,194 - 45,203,825 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	43,868,133 - 43,869,380 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	45,866,098 - 45,867,346 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	45,866,110 - 45,867,304 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	45,330,849 - 45,332,085 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	44,895,678 - 44,896,925 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	45,633,813 - 45,635,061 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Polr2l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	47,138,949 - 47,139,737 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936544	652,968 - 653,683 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936544	652,968 - 653,683 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC102164011
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	109,821,516 - 109,823,848 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	121,251,546 - 121,253,428 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR2L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	646,747 - 649,196 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	646,748 - 649,029 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	97,736,329 - 97,738,772 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr2l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	21,678,970 - 21,680,977 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624766	21,678,994 - 21,680,977 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Polr2l
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	8,012,865 - 8,015,179 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Polr2l
12 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	226
Count of miRNA genes:	153
Interacting mature miRNAs:	169
Transcripts:	ENSRNOT00000026113, ENSRNOT00000071028
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	183564652	228564652	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	193964073	238964073	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	194575422	239575422	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	193400541	238400541	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	202543537	247543537	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	194786607	207590403	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	205674651	250674651	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	203300512	229359342	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	191190115	223964326	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631260	Tcas2	Tongue tumor susceptibility QTL 2	4.93		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	201915593	208479939	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	178547286	206690557	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	192995199	237995199	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	201464383	246464383	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	203675682	248675682	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	205674651	250674651	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	185979875	230979875	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	197807365	233480676	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	193400541	238400541	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	202851915	223964440	Rat
6480783	Insul19	Insulin level QTL 19	4.33		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	203300512	213659238	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	191260175	236260175	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2325727	Pia41	Pristane induced arthritis QTL 41			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	188241285	233241285	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat

Markers in Region

RH141182

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	1	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	sensory system	visual system
7	1	18	52	67	138	95	11	51	36	32	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001143911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA924509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC109542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY325138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB314321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

NM_001143911 ⟹ NP_001137383

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	205,999,607 - 206,001,615 (-)	NCBI
mRatBN7.2	1	196,570,051 - 196,572,060 (-)	NCBI
Rnor_6.0	1	214,451,966 - 214,453,974 (-)	NCBI
Rnor_5.0	1	220,932,289 - 220,934,297 (-)	NCBI
RGSC_v3.4	1	201,659,267 - 201,661,275 (-)	RGD
Celera	1	194,203,547 - 194,205,555 (-)	RGD

Sequence:

show sequence

AGACGCCGCCATGATCATCCCAGTTCGCTGCTTCACCTGCGGGAAGATCGTCGGTAACAAATGG
GAAGCCTACCTGGGTCTGCTACAGGCAGAGTACACCGAGGGGGATGCCCTGGACGCTCTGGGCC
TGAAGCGTTACTGCTGCCGCCGCATGCTGCTCGCACACGTGGACCTGATTGAGAAACTGCTGAA
CTATGCACCCCTAGAGAAGTGACTGCTAGAGCCTGCCCTCCTCAGCTGGCCAAGGGCAATCTGT
CCTGCTGTATTCAAACTGAGGTGTTGGGGATGTGAGTGTATTGCCTGGCTGTGGCCCTGTGGCT
AAGTCCTGTCATCCTGGAAGGAACTGTTTAGTAAAGATCTTTGCAGAACCACCAAAAAAAAAAA
AAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001137383	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP92539	(Get FASTA)	NCBI Sequence Viewer
	EDM12089	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071181.1

RefSeq Acc Id:	NP_001137383 ⟸ NM_001143911
- UniProtKB:	A6HY08 (UniProtKB/TrEMBL), A0A0G2JZT9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAP LEK hide sequence

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566209	AgrOrtholog
BioCyc Gene	G2FUF-56946	BioCyc
Ensembl Genes	ENSRNOG00000023805	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030597.3	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	RNA_pol_su_RPB10	UniProtKB/TrEMBL
	RNA_pol_suN_Zn-BS	UniProtKB/TrEMBL
	RPABC5/Rpb10	UniProtKB/TrEMBL
KEGG Report	rno:502374	UniProtKB/TrEMBL
NCBI Gene	502374	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC5	UniProtKB/TrEMBL
	DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC5 FAMILY MEMBER	UniProtKB/TrEMBL
Pfam	RNA_pol_N	UniProtKB/TrEMBL
PhenoGen	Polr2l	PhenoGen
PIRSF	RNA_pol_N/8_sub	UniProtKB/TrEMBL
PROSITE	RNA_POL_N_8KD	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000023805	RatGTEx
Superfamily-SCOP	RNA polymerase subunit RPB10	UniProtKB/TrEMBL
UniProt	A0A0G2JZT9	ENTREZGENE, UniProtKB/TrEMBL
	A6HY08	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Polr2l	RNA polymerase II, I and III subunit L	LOC100911840	DNA-directed RNA polymerases I, II, and III subunit RPABC5-like	Data merged from RGD:6490627	737654	PROVISIONAL
2020-06-22	Polr2l	RNA polymerase II, I and III subunit L	Polr2l	RNA polymerase II subunit L	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-07-21	Polr2l	RNA polymerase II subunit L	Polr2l	polymerase (RNA) II subunit L	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-06-29	Polr2l	polymerase (RNA) II subunit L	Polr2l	polymerase (RNA) II (DNA directed) polypeptide L	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911840	DNA-directed RNA polymerases I, II, and III subunit RPABC5-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2009-01-09	Polr2l	polymerase (RNA) II (DNA directed) polypeptide L	LOC502374	hypothetical protein LOC502374	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2006-02-09	LOC502374	hypothetical protein LOC502374			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)