Symbol:
Btk
Name:
Bruton tyrosine kinase
RGD ID:
1359683
Description:
Enables protein tyrosine kinase activity. Involved in several processes, including positive regulation of gene expression; positive regulation of hypersensitivity; and regulation of B cell activation. Located in perinuclear region of cytoplasm. Used to study arthus reaction. Human ortholog(s) of this gene implicated in agammaglobulinemia (multiple); isolated growth hormone deficiency type III; and lymphoma (multiple). Orthologous to human BTK (Bruton tyrosine kinase); PARTICIPATES IN erythropoietin signaling pathway; FasL mediated signaling pathway; Fc epsilon receptor mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Bruton agammaglobulinemia tyrosine kinase; tyrosine-protein kinase BTK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 102,016,070 - 102,055,448 (-) NCBI GRCr8 mRatBN7.2 X 97,722,796 - 97,762,315 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 97,722,802 - 97,761,853 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 99,397,016 - 99,436,088 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 102,907,749 - 102,946,794 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 100,410,180 - 100,449,237 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 105,360,922 - 105,390,580 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 105,360,922 - 105,390,580 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 105,250,666 - 105,279,934 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 121,998,935 - 122,030,289 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 122,072,367 - 122,103,722 (-) NCBI Celera X 98,764,036 - 98,794,122 (-) NCBI Celera Cytogenetic Map X q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Btk Rat (S)-nicotine decreases expression ISO BTK (Homo sapiens) 6480464 Nicotine results in decreased expression of BTK mRNA CTD PMID:18247414 Btk Rat 1,2-dichloroethane decreases expression ISO Btk (Mus musculus) 6480464 ethylene dichloride results in decreased expression of BTK mRNA CTD PMID:28960355 Btk Rat 1,2-dimethylhydrazine increases expression ISO Btk (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BTK mRNA CTD PMID:22206623 Btk Rat 17alpha-ethynylestradiol multiple interactions ISO Btk (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BTK mRNA CTD PMID:17942748 Btk Rat 17beta-estradiol increases expression ISO BTK (Homo sapiens) 6480464 Estradiol results in increased expression of BTK mRNA CTD PMID:23373633 Btk Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of BTK mRNA CTD PMID:32741896 Btk Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of BTK mRNA CTD PMID:32741896 Btk Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO BTK (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Btk Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Btk (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BTK mRNA CTD PMID:17942748 Btk Rat 2,4,6-tribromophenol decreases expression ISO BTK (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Btk Rat 2-naphthylamine increases expression ISO BTK (Homo sapiens) 6480464 2-Naphthylamine results in increased expression of BTK mRNA CTD PMID:18247414 Btk Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO BTK (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of BTK protein CTD PMID:31675489 Btk Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of BTK mRNA CTD PMID:30071829 Btk Rat 4,4'-sulfonyldiphenol increases expression ISO BTK (Homo sapiens) 6480464 bisphenol S results in increased expression of BTK mRNA CTD PMID:30616060 Btk Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BTK mRNA CTD PMID:31881176 Btk Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of BTK mRNA CTD PMID:28959563 Btk Rat alpha-amanitin affects expression ISO Btk (Mus musculus) 6480464 Alpha-Amanitin affects the expression of BTK mRNA CTD PMID:38531469 Btk Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of BTK mRNA CTD PMID:35163327 Btk Rat arsenous acid increases expression ISO BTK (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of BTK mRNA CTD PMID:23911876 Btk Rat benzo[a]pyrene decreases expression ISO Btk (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BTK mRNA CTD PMID:21569818 Btk Rat benzo[a]pyrene affects methylation ISO BTK (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BTK 5' UTR and Benzo(a)pyrene affects the methylation of BTK promoter CTD PMID:27901495 Btk Rat benzo[a]pyrene increases expression ISO BTK (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BTK mRNA CTD PMID:18247414 Btk Rat benzo[a]pyrene increases mutagenesis ISO BTK (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of BTK gene CTD PMID:25435355 Btk Rat benzo[e]pyrene increases methylation ISO BTK (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of BTK intron CTD PMID:30157460 Btk Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BTK mRNA CTD PMID:25181051 and PMID:30816183 Btk Rat bisphenol A decreases expression ISO BTK (Homo sapiens) 6480464 bisphenol A results in decreased expression of BTK protein CTD PMID:31675489 Btk Rat bisphenol A increases expression ISO Btk (Mus musculus) 6480464 bisphenol A results in increased expression of BTK mRNA CTD PMID:38701888 Btk Rat bisphenol A decreases methylation ISO Btk (Mus musculus) 6480464 bisphenol A results in decreased methylation of BTK promoter CTD PMID:27312807 Btk Rat buta-1,3-diene decreases expression ISO Btk (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of BTK mRNA CTD PMID:29038090 Btk Rat calcium atom affects transport ISO Btk (Mus musculus) 6480464 BTK protein affects the transport of Calcium CTD PMID:12848851 Btk Rat calcium(0) affects transport ISO Btk (Mus musculus) 6480464 BTK protein affects the transport of Calcium CTD PMID:12848851 Btk Rat carbon nanotube increases expression ISO Btk (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of BTK mRNA CTD PMID:25554681 Btk Rat CGP 52608 multiple interactions ISO BTK (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BTK gene] CTD PMID:28238834 Btk Rat choline multiple interactions ISO Btk (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BTK mRNA CTD PMID:20938992 Btk Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of BTK mRNA CTD PMID:17898221 Btk Rat copper atom multiple interactions ISO BTK (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of BTK mRNA CTD PMID:24690739 Btk Rat copper(0) multiple interactions ISO BTK (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of BTK mRNA CTD PMID:24690739 Btk Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of BTK mRNA CTD PMID:27523638 Btk Rat decabromodiphenyl ether decreases expression ISO BTK (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of BTK protein CTD PMID:31675489 Btk Rat diarsenic trioxide increases expression ISO BTK (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of BTK mRNA CTD PMID:23911876 Btk Rat dimethylarsinic acid multiple interactions ISO Btk (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BTK mRNA CTD PMID:34876320 Btk Rat diquat decreases expression ISO Btk (Mus musculus) 6480464 Diquat results in decreased expression of BTK mRNA CTD PMID:36851058 Btk Rat disulfiram multiple interactions ISO BTK (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of BTK mRNA CTD PMID:24690739 Btk Rat folic acid multiple interactions ISO Btk (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BTK mRNA CTD PMID:20938992 Btk Rat formaldehyde decreases expression ISO BTK (Homo sapiens) 6480464 Formaldehyde results in decreased expression of BTK mRNA CTD PMID:23649840 Btk Rat ibrutinib decreases response to substance ISO BTK (Homo sapiens) 6480464 BTK gene mutant form results in decreased susceptibility to ibrutinib and BTK protein mutant form results in decreased susceptibility to ibrutinib CTD PMID:25189416 and PMID:26254443 Btk Rat ibrutinib multiple interactions ISO BTK (Homo sapiens) 6480464 (+)-JQ1 compound promotes the reaction [ibrutinib results in decreased phosphorylation of and results in decreased expression of BTK protein] more ... CTD PMID:26254443 Btk Rat ibrutinib affects binding ISO BTK (Homo sapiens) 6480464 ibrutinib binds to BTK protein CTD PMID:26174628 and PMID:26675335 Btk Rat ibrutinib decreases activity ISO BTK (Homo sapiens) 6480464 ibrutinib results in decreased activity of BTK protein CTD PMID:23296407 and PMID:23425038 Btk Rat ibrutinib decreases phosphorylation ISO BTK (Homo sapiens) 6480464 ibrutinib results in decreased phosphorylation of BTK protein CTD PMID:26254443 Btk Rat L-methionine multiple interactions ISO Btk (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BTK mRNA CTD PMID:20938992 Btk Rat leflunomide decreases expression ISO BTK (Homo sapiens) 6480464 leflunomide results in decreased expression of BTK mRNA CTD PMID:28988120 Btk Rat methapyrilene increases methylation ISO BTK (Homo sapiens) 6480464 Methapyrilene results in increased methylation of BTK intron CTD PMID:30157460 Btk Rat methyl methanesulfonate decreases expression ISO BTK (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of BTK mRNA CTD PMID:23649840 Btk Rat methylarsonic acid multiple interactions ISO Btk (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BTK mRNA CTD PMID:34876320 Btk Rat mifepristone increases expression ISO BTK (Homo sapiens) 6480464 Mifepristone results in increased expression of BTK mRNA CTD PMID:17584828 Btk Rat nickel atom increases expression ISO BTK (Homo sapiens) 6480464 Nickel results in increased expression of BTK mRNA CTD PMID:25583101 Btk Rat nicotine decreases expression ISO BTK (Homo sapiens) 6480464 Nicotine results in decreased expression of BTK mRNA CTD PMID:18247414 Btk Rat nitrates multiple interactions ISO Btk (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BTK mRNA CTD PMID:35964746 Btk Rat ozone multiple interactions ISO Btk (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of BTK mRNA CTD PMID:34911549 Btk Rat resveratrol multiple interactions ISO BTK (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BTK mRNA more ... CTD PMID:23557933 and PMID:26482867 Btk Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of BTK mRNA CTD PMID:32721576 Btk Rat sirolimus multiple interactions ISO Btk (Mus musculus) 6480464 Sirolimus inhibits the reaction [IL2 protein results in increased expression of BTK mRNA] CTD PMID:11355896 Btk Rat sodium arsenate multiple interactions ISO Btk (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BTK mRNA CTD PMID:34876320 Btk Rat sodium arsenite multiple interactions ISO Btk (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BTK mRNA CTD PMID:34876320 Btk Rat sunitinib increases expression ISO BTK (Homo sapiens) 6480464 Sunitinib results in increased expression of BTK mRNA CTD PMID:31533062 Btk Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of BTK mRNA CTD PMID:32741896 Btk Rat thiram increases expression ISO BTK (Homo sapiens) 6480464 Thiram results in increased expression of BTK mRNA CTD PMID:38568856 Btk Rat titanium dioxide increases expression ISO Btk (Mus musculus) 6480464 titanium dioxide results in increased expression of BTK mRNA CTD PMID:35295148 Btk Rat triptonide increases expression ISO Btk (Mus musculus) 6480464 triptonide results in increased expression of BTK mRNA CTD PMID:33045310
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2-naphthylamine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP) alpha-amanitin (ISO) alpha-Zearalanol (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) calcium atom (ISO) calcium(0) (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dimethylarsinic acid (ISO) diquat (ISO) disulfiram (ISO) folic acid (ISO) formaldehyde (ISO) ibrutinib (ISO) L-methionine (ISO) leflunomide (ISO) methapyrilene (ISO) methyl methanesulfonate (ISO) methylarsonic acid (ISO) mifepristone (ISO) nickel atom (ISO) nicotine (ISO) nitrates (ISO) ozone (ISO) resveratrol (ISO) silicon dioxide (EXP) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone (EXP) thiram (ISO) titanium dioxide (ISO) triptonide (ISO)
Biological Process
adaptive immune response (IBA) B cell affinity maturation (IEA,ISO) B cell receptor signaling pathway (IBA,IEA,ISO) cell maturation (IEA,ISO) cellular response to interleukin-7 (IEA,ISO) cellular response to molecule of fungal origin (IDA) cellular response to reactive oxygen species (IMP) eosinophil homeostasis (IMP) histamine secretion by mast cell (IMP) intracellular signal transduction (IEA,ISO) monocyte proliferation (IMP) negative regulation of B cell activation (IMP) negative regulation of B cell proliferation (IEA,ISO) negative regulation of cytokine production (IEA,ISO) negative regulation of interleukin-10 production (IMP) negative regulation of leukocyte proliferation (IMP) neutrophil homeostasis (IMP) peptidyl-tyrosine autophosphorylation (IMP) peptidyl-tyrosine phosphorylation (ISO) positive regulation of B cell proliferation (IMP) positive regulation of cGAS/STING signaling pathway (IEA,ISO) positive regulation of immunoglobulin production (IMP) positive regulation of interleukin-17A production (IMP) positive regulation of interleukin-6 production (IMP) positive regulation of NLRP3 inflammasome complex assembly (IEA,ISO) positive regulation of phagocytosis (IMP) positive regulation of synoviocyte proliferation (IMP) positive regulation of tumor necrosis factor production (IMP) positive regulation of type I hypersensitivity (IMP) positive regulation of type III hypersensitivity (IMP) protein autophosphorylation (IDA) protein phosphorylation (ISO) proteoglycan catabolic process (IMP) response to lipopolysaccharide (IMP) T cell receptor signaling pathway (IBA)
Molecular Function
ATP binding (IEA) identical protein binding (IEA,ISO) kinase activity (IEA) metal ion binding (IEA) non-membrane spanning protein tyrosine kinase activity (IBA,IEA,ISO) nucleotide binding (IEA) phosphatidylinositol-3,4,5-trisphosphate binding (IEA,ISO) phospholipase activator activity (IEA,ISO) phospholipase binding (IEA,ISO) protein binding (ISO) protein kinase activity (IEA) protein tyrosine kinase activity (IDA,IEA,ISO) transferase activity (IEA) zinc ion binding (IEA)
1.
Bruton tyrosine kinase inhibitor ibrutinib (PCI-32765) has significant activity in patients with relapsed/refractory B-cell malignancies.
Advani RH, etal., J Clin Oncol. 2013 Jan 1;31(1):88-94. doi: 10.1200/JCO.2012.42.7906. Epub 2012 Oct 8.
2.
Discovery of LOU064 (Remibrutinib), a Potent and Highly Selective Covalent Inhibitor of Bruton's Tyrosine Kinase.
Angst D, etal., J Med Chem. 2020 May 28;63(10):5102-5118. doi: 10.1021/acs.jmedchem.9b01916. Epub 2020 Mar 4.
3.
Role of Bruton's Tyrosine Kinase in Stage III Colorectal Cancer.
Basile D, etal., Cancers (Basel). 2019 Jun 24;11(6). pii: cancers11060880. doi: 10.3390/cancers11060880.
4.
BTK Has Potential to Be a Prognostic Factor for Lung Adenocarcinoma and an Indicator for Tumor Microenvironment Remodeling: A Study Based on TCGA Data Mining.
Bi KW, etal., Front Oncol. 2020 Apr 15;10:424. doi: 10.3389/fonc.2020.00424. eCollection 2020.
5.
Ibrutinib significantly inhibited Bruton's tyrosine kinase (BTK) phosphorylation,in-vitro proliferation and enhanced overall survival in a preclinical Burkitt lymphoma (BL) model.
Chu Y, etal., Oncoimmunology. 2018 Oct 11;8(1):e1512455. doi: 10.1080/2162402X.2018.1512455. eCollection 2019.
6.
Bruton tyrosine kinase gene mutations in Argentina.
Danielian S, etal., Hum Mutat. 2003 Apr;21(4):451.
7.
Intracellular single-chain variable fragments directed to the Src homology 2 domains of Syk partially inhibit Fc epsilon RI signaling in the RBL-2H3 cell line.
Dauvillier S, etal., J Immunol. 2002 Sep 1;169(5):2274-83. doi: 10.4049/jimmunol.169.5.2274.
8.
Btk inhibitor ibrutinib reduces inflammatory myeloid cell responses in the lung during murine pneumococcal pneumonia.
de Porto AP, etal., Mol Med. 2019 Jan 15;25(1):3. doi: 10.1186/s10020-018-0069-7.
9.
Platelet Btk is Required for Maintaining Lung Vascular Integrity during Murine Pneumococcal Pneumosepsis.
de Porto APNA, etal., Thromb Haemost. 2019 Jun;119(6):930-940. doi: 10.1055/s-0039-1681046. Epub 2019 Mar 14.
10.
Mutation analysis of the Bruton's tyrosine kinase gene in X-linked agammaglobulinemia: identification of a mutation which affects the same codon as is altered in immunodeficient xid mice.
de Weers M, etal., Hum Mol Genet. 1994 Jan;3(1):161-6.
11.
Inhibiting Bruton's tyrosine kinase rescues mice from lethal influenza-induced acute lung injury.
Florence JM, etal., Am J Physiol Lung Cell Mol Physiol. 2018 Jul 1;315(1):L52-L58. doi: 10.1152/ajplung.00047.2018. Epub 2018 Mar 8.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
p65BTK is a novel potential actionable target in KRAS-mutated/EGFR-wild type lung adenocarcinoma.
Giordano F, etal., J Exp Clin Cancer Res. 2019 Jun 14;38(1):260. doi: 10.1186/s13046-019-1199-7.
14.
Evaluation of Experimental Infection with L. ( L.) Amazonensis in X-Linked Immunodeficient Mice.
Gonzaga WFKM, etal., J Parasitol. 2017 Dec;103(6):708-717. doi: 10.1645/16-145. Epub 2017 Aug 7.
15.
Silencing of Bruton's tyrosine kinase (Btk) using short interfering RNA duplexes (siRNA).
Heinonen JE, etal., FEBS Lett. 2002 Sep 11;527(1-3):274-8.
16.
Nonreceptor tyrosine kinases ITK and BTK negatively regulate mast cell proinflammatory responses to lipopolysaccharide.
Huang W, etal., J Allergy Clin Immunol. 2016 Apr;137(4):1197-205. doi: 10.1016/j.jaci.2015.08.056. Epub 2015 Nov 12.
17.
The tyrosine kinase Btk regulates the macrophage response to Listeria monocytogenes infection.
Köprülü AD, etal., PLoS One. 2013;8(3):e60476. doi: 10.1371/journal.pone.0060476. Epub 2013 Mar 27.
18.
BTK inhibitors synergise with 5-FU to treat drug-resistant TP53-null colon cancers.
Lavitrano M, etal., J Pathol. 2020 Feb;250(2):134-147. doi: 10.1002/path.5347. Epub 2019 Dec 2.
19.
Bruton's tyrosine kinase: cell biology, sequence conservation, mutation spectrum, siRNA modifications, and expression profiling.
Lindvall JM, etal., Immunol Rev 2005 Feb;203:200-15.
20.
Inhibition of B Cell Receptor Signaling by Ibrutinib in Primary CNS Lymphoma.
Lionakis MS, etal., Cancer Cell. 2017 Jun 12;31(6):833-843.e5. doi: 10.1016/j.ccell.2017.04.012. Epub 2017 May 25.
21.
Antiarthritis effect of a novel Bruton's tyrosine kinase (BTK) inhibitor in rat collagen-induced arthritis and mechanism-based pharmacokinetic/pharmacodynamic modeling: relationships between inhibition of BTK phosphorylation and efficacy.
Liu L, etal., J Pharmacol Exp Ther. 2011 Jul;338(1):154-63. doi: 10.1124/jpet.111.181545. Epub 2011 Apr 26.
22.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
23.
Fatal disseminated mouse adenovirus type 1 infection in mice lacking B cells or Bruton's tyrosine kinase.
Moore ML, etal., J Virol. 2004 Jun;78(11):5584-90. doi: 10.1128/JVI.78.11.5584-5590.2004.
24.
Correction of B-cell development in Btk-deficient mice using lentiviral vectors with codon-optimized human BTK.
Ng YY, etal., Leukemia. 2010 Sep;24(9):1617-30. doi: 10.1038/leu.2010.140. Epub 2010 Jun 24.
25.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
26.
A Btk transgene restores the antiviral TI-2 antibody responses of xid mice in a dose-dependent fashion.
Pinschewer DD, etal., Eur J Immunol. 1999 Sep;29(9):2981-7. doi: 10.1002/(SICI)1521-4141(199909)29:09<2981::AID-IMMU2981>3.0.CO;2-Y.
27.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
28.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
29.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
30.
PKC-interacting proteins: from function to pharmacology.
Poole AW, etal., Trends Pharmacol Sci. 2004 Oct;25(10):528-35.
31.
Purification of a major tyrosine kinase from RBL-2H3 cells phosphorylating Fc epsilon RI gamma-cytoplasmic domain and identification as the Btk tyrosine kinase.
Price DJ, etal., Biochim Biophys Acta. 1995 Mar 16;1265(2-3):133-42.
32.
Mutation of unique region of Bruton's tyrosine kinase in immunodeficient XID mice.
Rawlings DJ, etal., Science. 1993 Jul 16;261(5119):358-61.
33.
GOA pipeline
RGD automated data pipeline
34.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
35.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
36.
B lymphocytes inactivation by Ibrutinib limits endometriosis progression in mice.
Riccio LGC, etal., Hum Reprod. 2019 Jul 8;34(7):1225-1234. doi: 10.1093/humrep/dez071.
37.
Inhibition of Bruton tyrosine kinase in patients with severe COVID-19.
Roschewski M, etal., Sci Immunol. 2020 Jun 5;5(48). pii: 5/48/eabd0110. doi: 10.1126/sciimmunol.abd0110. Epub 2020 Jun 5.
38.
Ibrutinib enhances the antitumor immune response induced by intratumoral injection of a TLR9 ligand in mouse lymphoma.
Sagiv-Barfi I, etal., Blood. 2015 Mar 26;125(13):2079-86. doi: 10.1182/blood-2014-08-593137. Epub 2015 Feb 6.
39.
Tyrosine kinase activation in response to fungal spores is primarily dependent on endogenous reactive oxygen production in macrophages.
Shahan TA, etal., J Biol Chem. 2000 Apr 7;275(14):10175-81.
40.
Development and pharmacological validation of novel methods of B cell activation in rat whole blood.
Shin J, etal., J Pharmacol Toxicol Methods. 2015 Jan-Feb;71:61-7. doi: 10.1016/j.vascn.2014.12.006. Epub 2014 Dec 26.
41.
Oligomerization controls in tissue-specific manner ligand binding of native, affinity-purified p42(IP4)/centaurin alpha1 and cytohesins-proteins with high affinity for the messengers D-inositol 1,3,4,5-tetrakisphosphate/phosphatidylinositol 3,4,5-trisphosphate.
Stricker R, etal., Biochim Biophys Acta 2003 Sep 23;1651(1-2):102-15.
42.
Intestinal colonization by Candida albicans alters inflammatory responses in Bruton's tyrosine kinase-deficient mice.
Strijbis K, etal., PLoS One. 2014 Nov 7;9(11):e112472. doi: 10.1371/journal.pone.0112472. eCollection 2014.
43.
X-linked immunodeficient mice exhibit enhanced susceptibility to Cryptococcus neoformans Infection.
Szymczak WA, etal., mBio. 2013 Jul 2;4(4). pii: mBio.00265-13. doi: 10.1128/mBio.00265-13.
44.
Identification of the bruton tyrosine kinase (BTK) gene mutations in 20 Australian families with X-linked agammaglobulinemia (XLA).
Velickovic M, etal., Hum Mutat. 2004 Apr;23(4):398-9.
45.
Irreversible inhibition of BTK kinase by a novel highly selective inhibitor CHMFL-BTK-11 suppresses inflammatory response in rheumatoid arthritis model.
Wu H, etal., Sci Rep. 2017 Mar 28;7(1):466. doi: 10.1038/s41598-017-00482-4.
46.
RN486, a selective Bruton's tyrosine kinase inhibitor, abrogates immune hypersensitivity responses and arthritis in rodents.
Xu D, etal., J Pharmacol Exp Ther. 2012 Apr;341(1):90-103. doi: 10.1124/jpet.111.187740. Epub 2012 Jan 6.
47.
Sustained correction of B-cell development and function in a murine model of X-linked agammaglobulinemia (XLA) using retroviral-mediated gene transfer.
Yu PW, etal., Blood. 2004 Sep 1;104(5):1281-90. doi: 10.1182/blood-2003-09-3044. Epub 2004 May 13.
48.
Nonclinical Safety Assessment of Zanubrutinib: A Novel Irreversible BTK Inhibitor.
Zhang C and Tian B, Int J Toxicol. 2020 May/Jun;39(3):232-240. doi: 10.1177/1091581820918511.
49.
B-Cell Lymphoma Patient-Derived Xenograft Models Enable Drug Discovery and Are a Platform for Personalized Therapy.
Zhang L, etal., Clin Cancer Res. 2017 Aug 1;23(15):4212-4223. doi: 10.1158/1078-0432.CCR-16-2703. Epub 2017 Mar 27.
Btk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 102,016,070 - 102,055,448 (-) NCBI GRCr8 mRatBN7.2 X 97,722,796 - 97,762,315 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 97,722,802 - 97,761,853 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 99,397,016 - 99,436,088 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 102,907,749 - 102,946,794 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 100,410,180 - 100,449,237 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 105,360,922 - 105,390,580 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 105,360,922 - 105,390,580 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 105,250,666 - 105,279,934 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 121,998,935 - 122,030,289 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 122,072,367 - 122,103,722 (-) NCBI Celera X 98,764,036 - 98,794,122 (-) NCBI Celera Cytogenetic Map X q32 NCBI
BTK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 101,349,450 - 101,390,796 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 101,349,338 - 101,390,796 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 100,604,438 - 100,645,784 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 100,491,098 - 100,527,838 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 100,410,586 - 100,447,327 NCBI Celera X 101,123,894 - 101,160,669 (-) NCBI Celera Cytogenetic Map X q22.1 NCBI HuRef X 90,410,583 - 90,447,505 (-) NCBI HuRef CHM1_1 X 100,497,918 - 100,534,692 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 99,793,571 - 99,834,908 (-) NCBI T2T-CHM13v2.0
Btk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 133,443,083 - 133,484,366 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 133,443,085 - 133,484,319 (-) Ensembl GRCm39 Ensembl GRCm38 X 134,542,334 - 134,583,628 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 134,542,336 - 134,583,570 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 131,076,880 - 131,117,679 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 129,888,761 - 129,929,466 (-) NCBI MGSCv36 mm8 Celera X 117,421,885 - 117,462,725 (-) NCBI Celera Cytogenetic Map X E3 NCBI cM Map X 56.18 NCBI
Btk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955503 7,482,793 - 7,515,120 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955503 7,483,819 - 7,515,085 (-) NCBI ChiLan1.0 ChiLan1.0
BTK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 100,948,666 - 100,985,544 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 100,952,265 - 100,989,149 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 90,551,874 - 90,588,786 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 100,684,017 - 100,720,868 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 100,684,017 - 100,725,187 (-) Ensembl panpan1.1 panPan2
BTK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 75,270,952 - 75,302,663 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 75,270,979 - 75,302,562 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 X 76,691,359 - 76,723,087 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 76,691,367 - 76,723,042 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 74,255,464 - 74,287,205 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 75,915,885 - 75,947,610 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 75,678,325 - 75,710,045 (-) NCBI UU_Cfam_GSD_1.0
Btk
BTK
BTK
Btk
.
Predicted Target Of
Count of predictions: 114 Count of miRNA genes: 93 Interacting mature miRNAs: 95 Transcripts: ENSRNOT00000043770 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 724551 Glom1 Glomerulus QTL 1 2.8 0.0004 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) X 75294106 120294106 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
DXGot170
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 97,732,291 - 97,732,486 (+) MAPPER mRatBN7.2 Rnor_6.0 X 105,370,050 - 105,370,241 NCBI Rnor6.0 Rnor_5.0 X 105,259,792 - 105,259,983 UniSTS Rnor5.0 RGSC_v3.4 X 122,008,431 - 122,008,625 UniSTS RGSC3.4 Celera X 98,773,135 - 98,773,329 UniSTS Cytogenetic Map X q34 UniSTS
PMC24278P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 97,753,197 - 97,753,330 (+) MAPPER mRatBN7.2 Rnor_6.0 X 105,390,420 - 105,390,552 NCBI Rnor6.0 Rnor_5.0 X 105,279,774 - 105,279,906 UniSTS Rnor5.0 RGSC_v3.4 X 122,030,129 - 122,030,261 UniSTS RGSC3.4 Celera X 98,793,962 - 98,794,094 UniSTS Cytogenetic Map X q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000077547 ⟹ ENSRNOP00000071684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 97,722,802 - 97,761,853 (-) Ensembl Rnor_6.0 Ensembl X 105,360,922 - 105,390,580 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086863 ⟹ ENSRNOP00000073875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 97,722,802 - 97,761,853 (-) Ensembl Rnor_6.0 Ensembl X 105,364,098 - 105,385,852 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109583 ⟹ ENSRNOP00000093229
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 97,722,802 - 97,761,853 (-) Ensembl
RefSeq Acc Id:
NM_001007798 ⟹ NP_001007799
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 102,016,074 - 102,055,143 (-) NCBI mRatBN7.2 X 97,722,800 - 97,761,873 (-) NCBI Rnor_6.0 X 105,360,922 - 105,390,580 (-) NCBI Rnor_5.0 X 105,250,666 - 105,279,934 (-) NCBI RGSC_v3.4 X 121,998,935 - 122,030,289 (-) RGD Celera X 98,764,036 - 98,794,122 (-) RGD
Sequence:
ATGGCTGCTGTGATACTGGAGAGCATCTTTCTGAAGCGCTCCCAGCAGAAAAAGAAAACATCACCTTTAAATTTTAAGAAGCGCCTATTTCTCCTGACTGTGCACAAACTTTCATACTATGAATATGA
hide sequence
RefSeq Acc Id:
XM_039099952 ⟹ XP_038955880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 102,016,070 - 102,055,153 (-) NCBI mRatBN7.2 X 97,722,796 - 97,761,890 (-) NCBI
RefSeq Acc Id:
XM_039099953 ⟹ XP_038955881
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 102,016,070 - 102,054,940 (-) NCBI mRatBN7.2 X 97,722,796 - 97,761,597 (-) NCBI
RefSeq Acc Id:
XM_039099954 ⟹ XP_038955882
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 102,016,070 - 102,055,448 (-) NCBI mRatBN7.2 X 97,722,796 - 97,762,315 (-) NCBI
RefSeq Acc Id:
NP_001007799 ⟸ NM_001007798
- UniProtKB:
A0A0G2K6M9 (UniProtKB/TrEMBL), Q5S255 (UniProtKB/TrEMBL)
- Sequence:
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPVPRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000071684 ⟸ ENSRNOT00000077547
Ensembl Acc Id:
ENSRNOP00000073875 ⟸ ENSRNOT00000086863
RefSeq Acc Id:
XP_038955882 ⟸ XM_039099954
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K6M9 (UniProtKB/TrEMBL), Q5S255 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955880 ⟸ XM_039099952
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K6M9 (UniProtKB/TrEMBL), Q5S255 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955881 ⟸ XM_039099953
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K6M9 (UniProtKB/TrEMBL), Q5S255 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093229 ⟸ ENSRNOT00000109583
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-11
Btk
Bruton tyrosine kinase
Btk
Bruton agammaglobulinemia tyrosine kinase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Btk
Bruton agammaglobulinemia tyrosine kinase
Symbol and Name status set to approved
1299863 APPROVED
2005-07-29
Btk
Bruton agammaglobulinemia tyrosine kinase
Symbol and Name status set to provisional
70820 PROVISIONAL
