Serpinf2 (serpin family F member 2)

Gene: Serpinf2 (serpin family F member 2) Rattus norvegicus

Analyze

Symbol:

Serpinf2

Name:

serpin family F member 2

RGD ID:

1306692

Description:

Enables serine-type endopeptidase inhibitor activity. Involved in negative regulation of fibrinolysis and response to organic substance. Located in extracellular space. Used to study acute necrotizing pancreatitis. Biomarker of familial hyperlipidemia. Human ortholog(s) of this gene implicated in COVID-19 and alpha-2-plasmin inhibitor deficiency. Orthologous to human SERPINF2 (serpin family F member 2); PARTICIPATES IN fibrinolysis pathway; coagulation cascade pathway; complement system pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-2-antiplasmin; LOC287527; serine (or cysteine) peptidase inhibitor, clade F, member 2; serine (or cysteine) proteinase inhibitor, clade F, member 2; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	60,770,698 - 60,778,782 (-)	NCBI		GRCr8
mRatBN7.2	10	60,272,400 - 60,280,506 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	60,272,400 - 60,281,243 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	64,919,282 - 64,927,358 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	64,424,887 - 64,432,963 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	59,887,278 - 59,895,354 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	62,264,247 - 62,272,353 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	62,264,788 - 62,273,119 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	61,978,965 - 61,987,194 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	62,748,116 - 62,756,200 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	62,761,738 - 62,769,823 (-)	NCBI
Celera	10	59,300,854 - 59,308,938 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute necrotizing pancreatitis (IDA)

alpha-2-plasmin inhibitor deficiency (ISO,ISS)

coronary artery disease (ISO)

Coronary Disease (ISO)

COVID-19 (ISO)

familial hyperlipidemia (IEP)

genetic disease (ISO)

Hemorrhage (ISO)

hemorrhagic disease (ISO)

Hypercholesterolemia (ISO)

Hyperlipoproteinemias (ISO)

hypertension (ISO)

Hypertriglyceridemia (ISO)

pre-eclampsia (ISO)

pulmonary embolism (ISO)

systemic scleroderma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

C60 fullerene (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

clofibrate (EXP)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diarsenic trioxide (ISO)

diclofenac (ISO)

dimethylarsinic acid (ISO)

endosulfan (EXP)

Ethyl icosapentate (EXP)

flutamide (EXP)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

graphite (EXP)

GW 4064 (ISO)

iron dichloride (ISO)

L-ethionine (EXP)

lead(0) (ISO)

lipopolysaccharide (ISO)

methidathion (ISO)

methylarsonic acid (ISO)

nefazodone (EXP)

nickel atom (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

omeprazole (EXP)

paracetamol (ISO)

perfluorodecanoic acid (ISO)

perfluorododecanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (EXP,ISO)

potassium dichromate (ISO)

quercetin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

tamoxifen (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

trichloroethene (EXP,ISO)

triclosan (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood vessel morphogenesis (ISO)

collagen fibril organization (ISO)

maintenance of blood vessel diameter homeostasis by renin-angiotensin (ISO)

negative regulation of fibrinolysis (IMP,ISO)

negative regulation of plasminogen activation (ISO)

positive regulation of cell differentiation (ISO)

positive regulation of collagen biosynthetic process (ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

positive regulation of JNK cascade (ISO)

positive regulation of smooth muscle cell proliferation (ISO)

positive regulation of stress fiber assembly (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of transforming growth factor beta production (ISO)

response to organic substance (IEP)

Cellular Component

cell surface (ISO)

extracellular space (IBA,IDA,ISO)

fibrinogen complex (ISO)

Molecular Function

endopeptidase inhibitor activity (ISO)

protease binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

serine-type endopeptidase inhibitor activity (IBA,IDA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

coagulation cascade pathway (IEA)

complement system pathway (IEA)

fibrinolysis pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Fibrinolytic response in subjects with hypertriglyceridemia and low HDL cholesterol.	Cimminiello C, etal., Biomed Pharmacother. 1997;51(4):164-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	[Fibrinolysis parameters: plasmin-alpha2 antiplasmin complexes (PAP) and D-dimers in acute coronary syndromes without ST segment elevation]	Grabarczyk E, etal., Pol Merkur Lekarski. 2004 Dec;17(102):555-7.
5.	Two forms of alpha 2-antiplasmin: post-traumatic changes in the rat.	Hogstorp H and Carlin G, Ups J Med Sci. 1987;92(1):79-83.
6.	Plasma plasmin-alpha2-plasmin inhibitor complex levels are increased in systemic sclerosis patients with pulmonary hypertension.	Jinnin M, etal., Rheumatology (Oxford). 2003 Feb;42(2):240-3.
7.	Polski tygodnik lekarski (Warsaw, Poland : 1960)	Kopieczna-Grzebieniak E, etal., Pol Tyg Lek. 1992 Jan 6-13;47(1-2):12-4.
8.	Proteases and protease inhibitors in cerulein-induced acute pancreatitis in rats.	Kruse P, etal., J Surg Res. 1999 Aug;85(2):294-300.
9.	Purification and some properties of rat alpha 2-plasmin inhibitor.	Kumada T and Abiko Y, Thromb Res. 1984 Oct 15;36(2):143-52.
10.	Physiological role of alpha 2-plasmin inhibitor in rats.	Kumada T and Abiko Y, Thromb Res. 1984 Oct 15;36(2):153-63.
11.	A novel missense mutation in the human plasmin inhibitor (alpha2-antiplasmin) gene associated with a bleeding tendency.	Lind B and Thorsen S, Br J Haematol. 1999 Nov;107(2):317-22.
12.	Basic mechanisms and regulation of fibrinolysis.	Longstaff C and Kolev K, J Thromb Haemost. 2015 Jun;13 Suppl 1:S98-105. doi: 10.1111/jth.12935.
13.	Increased blood viscosity and fibrinolytic inhibitor in type II hyperlipoproteinaemia.	Lowe GD, etal., Lancet. 1982 Feb 27;1(8270):472-5.
14.	Haemostasis balance disorders in patients with essential hypertension.	Makris TK, etal., Thromb Res. 1997 Oct 15;88(2):99-107.
15.	Alpha2-antiplasmin plays a significant role in acute pulmonary embolism.	Matsuno H, etal., J Thromb Haemost. 2003 Aug;1(8):1734-9.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Urinary coagulation-fibrinolysis, kallirein-kinin systems and kininase in cases of preclampsia.	Mutoh S, etal., Agents Actions Suppl. 1992;38 ( Pt 2):330-41.
18.	Changes in coagulative and fibrinolytic activities in Triton WR-1339-induced hyperlipidemia in rats.	Okazaki M, etal., Jpn J Pharmacol. 1990 Feb;52(2):353-61.
19.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
20.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
21.	Immune complement and coagulation dysfunction in adverse outcomes of SARS-CoV-2 infection.	Ramlall V, etal., Nat Med. 2020 Aug 3. pii: 10.1038/s41591-020-1021-2. doi: 10.1038/s41591-020-1021-2.
22.	GOA pipeline	RGD automated data pipeline
23.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
25.	Comprehensive gene review and curation	RGD comprehensive gene curation
26.	Inhibitors of fibrinolysis are elevated in atherosclerotic plaque.	Robbie LA, etal., Arterioscler Thromb Vasc Biol. 1996 Apr;16(4):539-45.
27.	Activation of the fibrinolytic system in patients with coronary artery disease and hyperfibrinogenemia.	Stein D, etal., Thromb Haemost. 1997 May;77(5):970-4.

Additional References at PubMed

PMID:134998	PMID:6980881	PMID:12477932	PMID:15853774	PMID:17317851	PMID:17958745	PMID:18436805	PMID:19073825	PMID:20008146	PMID:22516433	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Serpinf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	60,770,698 - 60,778,782 (-)	NCBI		GRCr8
mRatBN7.2	10	60,272,400 - 60,280,506 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	60,272,400 - 60,281,243 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	64,919,282 - 64,927,358 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	64,424,887 - 64,432,963 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	59,887,278 - 59,895,354 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	62,264,247 - 62,272,353 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	62,264,788 - 62,273,119 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	61,978,965 - 61,987,194 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	62,748,116 - 62,756,200 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	62,761,738 - 62,769,823 (-)	NCBI
Celera	10	59,300,854 - 59,308,938 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

SERPINF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	1,742,871 - 1,755,265 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	1,742,836 - 1,755,265 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	1,646,165 - 1,658,559 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	1,592,880 - 1,605,309 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	1,595,035 - 1,605,309	NCBI
Celera	17	1,661,914 - 1,674,664 (+)	NCBI		Celera
Cytogenetic Map	17	p13.3	NCBI
HuRef	17	1,543,280 - 1,555,830 (+)	NCBI		HuRef
CHM1_1	17	1,654,916 - 1,666,631 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	1,632,294 - 1,643,959 (+)	NCBI		T2T-CHM13v2.0

Serpinf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	75,322,562 - 75,330,327 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	75,322,558 - 75,330,417 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	75,431,736 - 75,439,501 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	75,431,732 - 75,439,591 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	75,245,238 - 75,253,003 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	75,247,931 - 75,255,676 (-)	NCBI		MGSCv36	mm8
Celera	11	82,940,136 - 82,947,901 (-)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	45.89	NCBI

Serpinf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	1,442,010 - 1,449,242 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955481	1,441,262 - 1,449,078 (-)	NCBI	ChiLan1.0	ChiLan1.0

SERPINF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	9,313,280 - 9,326,540 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	11,279,789 - 11,293,061 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	1,725,469 - 1,738,887 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	1,618,426 - 1,631,571 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	1,618,549 - 1,631,570 (+)	Ensembl	panpan1.1		panPan2

SERPINF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	45,876,076 - 45,883,777 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	45,877,495 - 45,883,036 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	45,026,864 - 45,034,458 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	46,703,271 - 46,710,872 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	46,703,323 - 46,710,871 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	45,474,549 - 45,480,834 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	45,767,599 - 45,775,185 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	45,822,215 - 45,829,811 (+)	NCBI		UU_Cfam_GSD_1.0

Serpinf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	44,990,512 - 45,000,032 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936538	7,870,898 - 7,877,219 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936538	7,870,898 - 7,877,279 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SERPINF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	47,933,864 - 47,942,285 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	47,934,551 - 47,942,283 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SERPINF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	1,392,562 - 1,404,574 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	1,392,571 - 1,404,636 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	20,571,859 - 20,583,948 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Serpinf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	4,443,249 - 4,449,743 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	4,441,912 - 4,450,487 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Serpinf2
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	95
Interacting mature miRNAs:	112
Transcripts:	ENSRNOT00000004322
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	55273696	60677262	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat

Markers in Region

RH130729

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	60,272,519 - 60,272,704 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	62,264,367 - 62,264,551	NCBI	Rnor6.0
Rnor_5.0	10	61,979,085 - 61,979,269	UniSTS	Rnor5.0
RGSC_v3.4	10	62,748,236 - 62,748,420	UniSTS	RGSC3.4
Celera	10	59,300,974 - 59,301,158	UniSTS
Cytogenetic Map	10	q24	UniSTS

Serpinf2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	60,277,504 - 60,277,866 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	62,269,352 - 62,269,713	NCBI	Rnor6.0
Rnor_5.0	10	61,984,070 - 61,984,431	UniSTS	Rnor5.0
RGSC_v3.4	10	62,753,221 - 62,753,582	UniSTS	RGSC3.4
Celera	10	59,305,959 - 59,306,320	UniSTS
Cytogenetic Map	10	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			41	41		41				29	3
Low	3	14	15		19		3	3	63	6	31	11	3
Below cutoff		29	1				5	8	11		7		5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001011892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000004322 ⟹ ENSRNOP00000004322

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,272,400 - 60,281,243 (-)	Ensembl
Rnor_6.0 Ensembl	10	62,264,788 - 62,273,119 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103377 ⟹ ENSRNOP00000096218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,272,400 - 60,281,243 (-)	Ensembl

RefSeq Acc Id:

NM_001011892 ⟹ NP_001011892

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	60,770,698 - 60,778,782 (-)	NCBI
mRatBN7.2	10	60,272,400 - 60,280,484 (-)	NCBI
Rnor_6.0	10	62,264,247 - 62,272,331 (-)	NCBI
Rnor_5.0	10	61,978,965 - 61,987,194 (-)	NCBI
RGSC_v3.4	10	62,748,116 - 62,756,200 (-)	RGD
Celera	10	59,300,854 - 59,308,938 (-)	RGD

Sequence:

show sequence

CCGGGAGAACATCGTGTGCTGCGCTAAGAAGCCTGAAGAGGAACATGGCACTGCTCCGGGGGCT
CCTGGTACTTAGCTTGTCCTGTCTGCAAGGTCCCAGTTCAATGTTCTCTCCTGTGAGTGCCATG
GATCTCCCGGGCCAGCAGCCAGTGAGTGAGCAAGCCCAGCAGAAGCTGCCCCCACTTGCCCTCC
TCAAGTTGGGCAACCAGGATCTTGGTGACCATGCTACCCTGAAGAGGTCCCCAGGAGATTGCAA
GAGTGCCCCAACTACAGAGGAGACTCGCAGGCTGTCTCAGGCCATGATGGCTTTTACTACTGAC
CTGTTCTCCCTGGTGGCCCAAACATCCACCAGCTCCAACCTTGTCCTGTCACCCCTTAGTGTGG
CCCTAGCACTCTCTCACCTGGCACTAGGTGCTCGGAACCAAACACTGGAGAACCTGCAACGAGT
GCTGCACATGAACATGGGATCCTGCATCCCGCATCTACTGAGCCATTTCTGCCAGAACCTAAAC
CCCGGGACAATCCGACTGGCGGCCAGAATATACTTGCAGAAAGGATTTCCCATCAAAGATGATT
TCCTGGAGCAATCGGAAAAGCTCTTTGGCGCGAAGCCCGTGAAACTGACTGGAAGGCAGGAAGA
AGACCTGATGAACATCAACAAATGGGTGAAGGAGGCCACAGAAGGGAAGATTGAGGATTTCCTC
TCTGAGCTGCCGGATAACACCGTGCTGCTCCTCCTCAATGCCATCCACTTTCACGGTTTCTGGA
GGACCAAGTTTGACCCCAGCCTCACCCAGAAAGACTCCTTCCACCTGGACGAGCAGTTCACGGT
GCCAGTGGCCATGATGCACGCACAGTCATACCCCCTTCGATGGTTCCTGCTGGAGCAACCTGAG
ATACAGGTGGCTCATTTCCCATTTCAGAACAACATGAGCTTCGTGGTCATAATGCCCACTTACT
TTGGGTGGAACGTGTCCGAGGTACTAGCCAACCTGACCTGGGACACTCTGTACCAGCCCTCGAT
GCGGGAGAAGCCCACCAAGGTGCGGCTGCCTAAACTTCATCTGGAACAGCATCTGGACCTGGTG
GCCACCCTCAGCAAGCTGGGCCTACAGGACTTGTTCCAGAGCCCAGACCTGCGTGGGATCTCTG
ACCAGAGTCTGGTGGTGTCTAGTGTGCAGCACCAGTCTACCATGGAGCTCAGTGAGGCTGGTGT
GGAGGCAGCGGCAGCTACCAGCACAGCCATGACTCGAATGTCCCTTTCCTCCTTCTTTTTGAAC
CGACCATTCATCTTCTTCATCATGGAGGAGACCATAGGCATACCCCTCTTTGTGGGAAGTGTGA
GAAACCCTGACCCCAGTGCACAGCCCCAGCCCCAGGAACAGCAAGACTCCCCTGACAACAGGCG
CTTAGACCAGAATGACAAAGCTGACATCCCCGGAGGCAAGACCTTTGCTCCTGACTTGAAACTT
GTGCCCCGCCTGGAGGAAGATTATCCCCAGTTTAGCTCCCCCAAATGAGGAGGGGCCCTGGCCA
GCAGCATCCTGAGTCCCCACCTGGATCAGCCTCTCAACTCCTGTGACTCTTTCCAGCCAGCTTT
GTGGGATAGGGTGGGACCTGGGGGACAGTCACTGGGGATTGGAGGCGGGGTGGGGCCTGGGAGG
AGGCAGGCCCAGGGAGTCTTCATTGCTTCCCAAGGGGCCCAGGAGGTGACCTTTTGTGGGCTGG
CACTCGTGGATAGTTTTGGCAAGAGGTAGGTTGGGCTAGTCCCTAACTTAGAGTCCCTCCACAT
TTGTAAGCAGAGGCTAGAGAGGCCCTCTTTAGACATATCCCCAGATGCCCGGGTGGGAAAAAGA
CAAGTGTTGGTCTCCTGAGCTTAGACCGGCCTTGGTGTTCTACTCCATGGGTGGAGGCGGACCT
ACCCTGACTCTGATGTGCCTTGCTGAAGACATTCAGGTCCCCAACCTGTGTCCTGCCACCCAAG
CCACCCCTCTGGTTTTTGGAGATGCCAGCACTGCCAGGAGCCTTCCTCCATCTTCCTCTCGTCC
TCCTCTGCCAGGAAGCTCAGGGGCTGAGGCAGGGAAGGGCCCCTTTAGCTCCCAAGACTCTTTT
GTAAGGTTTTTGTAGTGATTTTTATGCCACCTGAATAAAGAATGAATGGATCGGGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017597114 ⟹ XP_017452603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	60,770,698 - 60,777,258 (-)	NCBI
mRatBN7.2	10	60,272,400 - 60,280,506 (-)	NCBI
Rnor_6.0	10	62,264,247 - 62,272,353 (-)	NCBI

Sequence:

show sequence

GAGCGTGGGGAGCAAGTGGGCTCCGGGAGAACATCGTGTGCTGCGCTAAGAAGCCTGAAGAGGA
ACATGGCACTGCTCCGGGGGCTCCTGGTACTTAGCTTGTCCTGTCTGCAAGGTCCCAGTTCAAT
GTTCTCTCCTGTGAGTGCCATGGATCTCCCGGGCCAGCAGCCAGTGAGTGAGCAAGCCCAGCAG
AAGCTGCCCCCACTTGCCCTCCTCAAGTTGGGCAACCAGGTACAATCAGGATCTTGGTGACCAT
GCTACCCTGAAGAGGTCCCCAGGAGATTGCAAGAGTGCCCCAACTACAGAGGAGACTCGCAGGC
TGTCTCAGGCCATGATGGCTTTTACTACTGACCTGTTCTCCCTGGTGGCCCAAACATCCACCAG
CTCCAACCTTGTCCTGTCACCCCTTAGTGTGGCCCTAGCACTCTCTCACCTGGCACTAGGTGCT
CGGAACCAAACACTGGAGAACCTGCAACGAGTGCTGCACATGAACATGGGATCCTGCATCCCGC
ATCTACTGAGCCATTTCTGCCAGAACCTAAACCCCGGGACAATCCGACTGGCGGCCAGAATATA
CTTGCAGAAAGGATTTCCCATCAAAGATGATTTCCTGGAGCAATCGGAAAAGCTCTTTGGCGCG
AAGCCCGTGAAACTGACTGGAAGGCAGGAAGAAGACCTGATGAACATCAACAAATGGGTGAAGG
AGGCCACAGAAGGGAAGATTGAGGATTTCCTCTCTGAGCTGCCGGATAACACCGTGCTGCTCCT
CCTCAATGCCATCCACTTTCACGGTTTCTGGAGGACCAAGTTTGACCCCAGCCTCACCCAGAAA
GACTCCTTCCACCTGGACGAGCAGTTCACGGTGCCAGTGGCCATGATGCACGCACAGTCATACC
CCCTTCGATGGTTCCTGCTGGAGCAACCTGAGATACAGGTGGCTCATTTCCCATTTCAGAACAA
CATGAGCTTCGTGGTCATAATGCCCACTTACTTTGGGTGGAACGTGTCCGAGGTACTAGCCAAC
CTGACCTGGGACACTCTGTACCAGCCCTCGATGCGGGAGAAGCCCACCAAGGTGCGGCTGCCTA
AACTTCATCTGGAACAGCATCTGGACCTGGTGGCCACCCTCAGCAAGCTGGGCCTACAGGACTT
GTTCCAGAGCCCAGACCTGCGTGGGATCTCTGACCAGAGTCTGGTGGTGTCTAGTGTGCAGCAC
CAGTCTACCATGGAGCTCAGTGAGGCTGGTGTGGAGGCAGCGGCAGCTACCAGCACAGCCATGA
CTCGAATGTCCCTTTCCTCCTTCTTTTTGAACCGACCATTCATCTTCTTCATCATGGAGGAGAC
CATAGGCATACCCCTCTTTGTGGGAAGTGTGAGAAACCCTGACCCCAGTGCACAGCCCCAGCCC
CAGGAACAGCAAGACTCCCCTGACAACAGGCGCTTAGACCAGAATGACAAAGCTGACATCCCCG
GAGGCAAGACCTTTGCTCCTGACTTGAAACTTGTGCCCCGCCTGGAGGAAGATTATCCCCAGTT
TAGCTCCCCCAAATGAGGAGGGGCCCTGGCCAGCAGCATCCTGAGTCCCCACCTGGATCAGCCT
CTCAACTCCTGTGACTCTTTCCAGCCAGCTTTGTGGGATAGGGTGGGACCTGGGGGACAGTCAC
TGGGGATTGGAGGCGGGGTGGGGCCTGGGAGGAGGCAGGCCCAGGGAGTCTTCATTGCTTCCCA
AGGGGCCCAGGAGGTGACCTTTTGTGGGCTGGCACTCGTGGATAGTTTTGGCAAGAGGTAGGTT
GGGCTAGTCCCTAACTTAGAGTCCCTCCACATTTGTAAGCAGAGGCTAGAGAGGCCCTCTTTAG
ACATATCCCCAGATGCCCGGGTGGGAAAAAGACAAGTGTTGGTCTCCTGAGCTTAGACCGGCCT
TGGTGTTCTACTCCATGGGTGGAGGCGGACCTACCCTGACTCTGATGTGCCTTGCTGAAGACAT
TCAGGTCCCCAACCTGTGTCCTGCCACCCAAGCCACCCCTCTGGTTTTTGGAGATGCCAGCACT
GCCAGGAGCCTTCCTCCATCTTCCTCTCGTCCTCCTCTGCCAGGAAGCTCAGGGGCTGAGGCAG
GGAAGGGCCCCTTTAGCTCCCAAGACTCTTTTGTAAGGTTTTTGTAGTGATTTTTATGCCACCT
GAATAAAGAATGAATGGATCGGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001011892	(Get FASTA)	NCBI Sequence Viewer
	XP_017452603	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79362	(Get FASTA)	NCBI Sequence Viewer
	EDM05210	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004322
	ENSRNOP00000004322.6
	ENSRNOP00000096218.1

RefSeq Acc Id:	NP_001011892 ⟸ NM_001011892
- Peptide Label:	precursor
- UniProtKB:	Q68FT8 (UniProtKB/TrEMBL), F7FHF3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALLRGLLVLSLSCLQGPSSMFSPVSAMDLPGQQPVSEQAQQKLPPLALLKLGNQDLGDHATLK RSPGDCKSAPTTEETRRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQT LENLQRVLHMNMGSCIPHLLSHFCQNLNPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVK LTGRQEEDLMNINKWVKEATEGKIEDFLSELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFH LDEQFTVPVAMMHAQSYPLRWFLLEQPEIQVAHFPFQNNMSFVVIMPTYFGWNVSEVLANLTWD TLYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLFQSPDLRGISDQSLVVSSVQHQSTM ELSEAGVEAAAATSTAMTRMSLSSFFLNRPFIFFIMEETIGIPLFVGSVRNPDPSAQPQPQEQQ DSPDNRRLDQNDKADIPGGKTFAPDLKLVPRLEEDYPQFSSPK hide sequence

RefSeq Acc Id:

XP_017452603 ⟸ XM_017597114

- Peptide Label:

isoform X1

- Sequence:

show sequence

MMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPHLLS
HFCQNLNPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEEDLMNINKWVKEATE
GKIEDFLSELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMMHAQSYPLRW
FLLEQPEIQVAHFPFQNNMSFVVIMPTYFGWNVSEVLANLTWDTLYQPSMREKPTKVRLPKLHL
EQHLDLVATLSKLGLQDLFQSPDLRGISDQSLVVSSVQHQSTMELSEAGVEAAAATSTAMTRMS
LSSFFLNRPFIFFIMEETIGIPLFVGSVRNPDPSAQPQPQEQQDSPDNRRLDQNDKADIPGGKT
FAPDLKLVPRLEEDYPQFSSPK

hide sequence

RefSeq Acc Id:

ENSRNOP00000004322 ⟸ ENSRNOT00000004322

RefSeq Acc Id:

ENSRNOP00000096218 ⟸ ENSRNOT00000103377

Protein Domains

SERPIN

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7FHF3-F1-model_v2	AlphaFold	F7FHF3	1-554	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306692	AgrOrtholog
BioCyc Gene	G2FUF-24212	BioCyc
Ensembl Genes	ENSRNOG00000003233	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004322	ENTREZGENE
	ENSRNOT00000004322.7	UniProtKB/TrEMBL
	ENSRNOT00000103377.1	UniProtKB/TrEMBL
Gene3D-CATH	2.30.39.10	UniProtKB/TrEMBL
	3.30.497.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7109243	IMAGE-MGC_LOAD
InterPro	Alpha2AP	UniProtKB/TrEMBL
	Protease_inhib_I4_serpin	UniProtKB/TrEMBL
	Protease_inhib_I4_serpin_CS	UniProtKB/TrEMBL
	Sepin_dom	UniProtKB/TrEMBL
	Serpin_sf	UniProtKB/TrEMBL
	Serpin_sf_1	UniProtKB/TrEMBL
	Serpin_sf_2	UniProtKB/TrEMBL
KEGG Report	rno:287527	UniProtKB/TrEMBL
MGC_CLONE	MGC:94844	IMAGE-MGC_LOAD
NCBI Gene	287527	ENTREZGENE
PANTHER	ALPHA-2-ANTIPLASMIN	UniProtKB/TrEMBL
	Prot_inh_serpin	UniProtKB/TrEMBL
Pfam	Serpin	UniProtKB/TrEMBL
PhenoGen	Serpinf2	PhenoGen
PROSITE	SERPIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003233	RatGTEx
SMART	SERPIN	UniProtKB/TrEMBL
Superfamily-SCOP	Prot_inh_serpin	UniProtKB/TrEMBL
UniProt	A0A8I6AQI7_RAT	UniProtKB/TrEMBL
	F7FHF3	ENTREZGENE, UniProtKB/TrEMBL
	Q68FT8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Serpinf2	serpin family F member 2	Serpinf2	serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-01-19	Serpinf2	serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2	Serpinf2	serine (or cysteine) peptidase inhibitor, clade F, member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Serpinf2	serine (or cysteine) peptidase inhibitor, clade F, member 2		serine (or cysteine) proteinase inhibitor, clade F, member 2	Name updated	1299863	APPROVED
2005-12-06	Serpinf2	serine (or cysteine) proteinase inhibitor, clade F, member 2	Serpinf2_predicted	serine (or cysteine) proteinase inhibitor, clade F, member 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Serpinf2_predicted	serine (or cysteine) proteinase inhibitor, clade F, member 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)