Symbol:
Tollip
Name:
toll interacting protein
RGD ID:
1304676
Description:
Enables SUMO binding activity; enzyme binding activity; and interleukin-1, type I receptor binding activity. Involved in positive regulation of protein sumoylation. Located in nuclear body and perinuclear region of cytoplasm. Orthologous to human TOLLIP (toll interacting protein); PARTICIPATES IN interleukin-1 signaling pathway; Toll-like receptor signaling pathway; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 4,4'-sulfonyldiphenol; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC361677; toll-interacting protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TOLLIP (toll interacting protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tollip (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tollip (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TOLLIP (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TOLLIP (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tollip (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TOLLIP (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TOLLIP (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tollip (toll interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TOLLIP (toll interacting protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tollip (toll interacting protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tollip (toll interacting protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tli-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CUE5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
DON1
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tollip
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 206,391,120 - 206,413,809 (-) NCBI GRCr8 mRatBN7.2 1 196,961,585 - 196,984,252 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 196,950,771 - 196,983,625 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 205,305,293 - 205,326,118 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 212,423,637 - 212,444,459 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 205,097,793 - 205,118,619 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 214,823,993 - 214,844,861 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 214,823,978 - 214,844,858 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 221,737,397 - 221,758,265 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 202,008,799 - 202,029,669 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 202,170,336 - 202,189,385 (-) NCBI Celera 1 194,590,002 - 194,610,866 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tollip Rat (1->4)-beta-D-glucan multiple interactions ISO Tollip (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOLLIP mRNA CTD PMID:36331819 Tollip Rat 1,2-dimethylhydrazine decreases expression ISO Tollip (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TOLLIP mRNA CTD PMID:22206623 Tollip Rat 17beta-estradiol decreases expression ISO Tollip (Mus musculus) 6480464 Estradiol results in decreased expression of TOLLIP mRNA CTD PMID:39298647 Tollip Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO TOLLIP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tollip Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Tollip (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Tollip Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Tollip Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tollip (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TOLLIP mRNA CTD PMID:21570461 Tollip Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tollip (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of TOLLIP mRNA CTD PMID:25975270 Tollip Rat 2,4,6-tribromophenol decreases expression ISO TOLLIP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tollip Rat 2,6-dimethoxyphenol multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Tollip Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO TOLLIP (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of TOLLIP protein CTD PMID:31675489 Tollip Rat 3,4-methylenedioxymethamphetamine increases expression ISO Tollip (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TOLLIP mRNA CTD PMID:20188158 Tollip Rat 4,4'-diaminodiphenylmethane increases expression ISO Tollip (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TOLLIP mRNA CTD PMID:18648102 Tollip Rat 4,4'-sulfonyldiphenol decreases expression ISO Tollip (Mus musculus) 6480464 bisphenol S results in decreased expression of TOLLIP mRNA CTD PMID:39298647 Tollip Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TOLLIP mRNA CTD PMID:36041667 Tollip Rat acrylamide increases expression ISO TOLLIP (Homo sapiens) 6480464 Acrylamide results in increased expression of TOLLIP mRNA CTD PMID:32763439 Tollip Rat aflatoxin B1 increases methylation ISO TOLLIP (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TOLLIP promoter CTD PMID:30157460 Tollip Rat aristolochic acid A increases expression ISO TOLLIP (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TOLLIP mRNA CTD PMID:33212167 Tollip Rat arsane affects methylation ISO TOLLIP (Homo sapiens) 6480464 Arsenic affects the methylation of TOLLIP gene CTD PMID:25304211 Tollip Rat arsane multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOLLIP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TOLLIP mRNA CTD PMID:39836092 Tollip Rat arsenic atom affects methylation ISO TOLLIP (Homo sapiens) 6480464 Arsenic affects the methylation of TOLLIP gene CTD PMID:25304211 Tollip Rat arsenic atom multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOLLIP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TOLLIP mRNA CTD PMID:39836092 Tollip Rat benzo[a]pyrene affects methylation ISO TOLLIP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TOLLIP 3' UTR and Benzo(a)pyrene affects the methylation of TOLLIP intron CTD PMID:27901495 and PMID:30157460 Tollip Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TOLLIP mRNA CTD PMID:25181051 Tollip Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TOLLIP mRNA CTD PMID:36041667 Tollip Rat bisphenol A multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TOLLIP gene CTD PMID:31601247 Tollip Rat bisphenol A decreases expression ISO TOLLIP (Homo sapiens) 6480464 bisphenol A results in decreased expression of TOLLIP protein CTD PMID:31675489 and PMID:34186270 Tollip Rat bisphenol A increases expression ISO TOLLIP (Homo sapiens) 6480464 bisphenol A results in increased expression of TOLLIP mRNA CTD PMID:29275510 Tollip Rat Bisphenol B increases expression ISO TOLLIP (Homo sapiens) 6480464 bisphenol B results in increased expression of TOLLIP protein CTD PMID:34186270 Tollip Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TOLLIP mRNA CTD PMID:36041667 Tollip Rat bisphenol F increases expression ISO TOLLIP (Homo sapiens) 6480464 bisphenol F results in increased expression of TOLLIP protein CTD PMID:34186270 Tollip Rat butanal decreases expression ISO TOLLIP (Homo sapiens) 6480464 butyraldehyde results in decreased expression of TOLLIP mRNA CTD PMID:26079696 Tollip Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TOLLIP mRNA CTD PMID:19167457 Tollip Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TOLLIP mRNA CTD PMID:33453195 Tollip Rat cadmium dichloride increases expression ISO TOLLIP (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TOLLIP mRNA CTD PMID:33129824 Tollip Rat cadmium selenide multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [cadmium selenide co-treated with zinc sulfide] results in increased expression of TOLLIP mRNA CTD PMID:22342292 Tollip Rat carbamazepine affects expression ISO TOLLIP (Homo sapiens) 6480464 Carbamazepine affects the expression of TOLLIP mRNA CTD PMID:25979313 Tollip Rat carbon nanotube increases expression ISO Tollip (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tollip Rat ceric oxide decreases expression ISO TOLLIP (Homo sapiens) 6480464 ceric oxide analog results in decreased expression of TOLLIP mRNA CTD PMID:24821434 Tollip Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of TOLLIP mRNA CTD PMID:23125180 Tollip Rat clobetasol increases expression ISO Tollip (Mus musculus) 6480464 Clobetasol results in increased expression of TOLLIP mRNA CTD PMID:27462272 Tollip Rat corn oil increases expression ISO Tollip (Mus musculus) 6480464 Corn Oil results in increased expression of TOLLIP mRNA CTD PMID:33263755 Tollip Rat decabromodiphenyl ether decreases expression ISO TOLLIP (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of TOLLIP protein CTD PMID:31675489 Tollip Rat dextran sulfate decreases expression ISO Tollip (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of TOLLIP protein CTD PMID:36543318 Tollip Rat dextran sulfate multiple interactions ISO Tollip (Mus musculus) 6480464 7-hydroxyl-1-methylindole-3-acetonitrile inhibits the reaction [Dextran Sulfate results in decreased expression of TOLLIP protein] and Mesalamine inhibits the reaction [Dextran Sulfate results in decreased expression of TOLLIP protein] CTD PMID:36543318 Tollip Rat Dibutyl phosphate affects expression ISO TOLLIP (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TOLLIP mRNA CTD PMID:37042841 Tollip Rat doxorubicin multiple interactions EXP 6480464 [Doxorubicin co-treated with Fungal Polysaccharides] results in decreased expression of TOLLIP mRNA CTD PMID:27181935 Tollip Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TOLLIP mRNA CTD PMID:29391264 Tollip Rat enzyme inhibitor multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TOLLIP protein CTD PMID:23301498 Tollip Rat epoxiconazole decreases expression ISO Tollip (Mus musculus) 6480464 epoxiconazole results in decreased expression of TOLLIP mRNA CTD PMID:35436446 Tollip Rat erlotinib hydrochloride multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [Erlotinib Hydrochloride results in decreased susceptibility to Erlotinib Hydrochloride] which results in increased expression of TOLLIP mRNA CTD PMID:27738319 Tollip Rat ethanol affects splicing ISO Tollip (Mus musculus) 6480464 Ethanol affects the splicing of TOLLIP mRNA CTD PMID:30319688 Tollip Rat ferroheme b increases expression ISO Tollip (Mus musculus) 6480464 Heme metabolite results in increased expression of TOLLIP mRNA CTD PMID:19191707 Tollip Rat fulvestrant multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TOLLIP gene CTD PMID:31601247 Tollip Rat furfural multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Tollip Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TOLLIP mRNA CTD PMID:33387578 Tollip Rat heme b increases expression ISO Tollip (Mus musculus) 6480464 Heme metabolite results in increased expression of TOLLIP mRNA CTD PMID:19191707 Tollip Rat indoles increases expression EXP 6480464 Indoles results in increased expression of TOLLIP mRNA CTD PMID:20521778 Tollip Rat indoles decreases expression EXP 6480464 Indoles results in decreased expression of TOLLIP mRNA CTD PMID:20521778 Tollip Rat ivermectin decreases expression ISO TOLLIP (Homo sapiens) 6480464 Ivermectin results in decreased expression of TOLLIP protein CTD PMID:32959892 Tollip Rat manganese atom multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOLLIP mRNA CTD PMID:39836092 Tollip Rat manganese(0) multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOLLIP mRNA CTD PMID:39836092 Tollip Rat manganese(II) chloride multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOLLIP mRNA CTD PMID:39836092 Tollip Rat mesalamine multiple interactions ISO Tollip (Mus musculus) 6480464 Mesalamine inhibits the reaction [Dextran Sulfate results in decreased expression of TOLLIP protein] CTD PMID:36543318 Tollip Rat neoechinulin A increases expression ISO Tollip (Mus musculus) 6480464 neoechinulin A results in increased expression of TOLLIP mRNA CTD PMID:19818335 Tollip Rat nitrates multiple interactions ISO Tollip (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TOLLIP mRNA CTD PMID:35964746 Tollip Rat ozone multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TOLLIP mRNA CTD PMID:35430440 Tollip Rat paracetamol affects expression ISO Tollip (Mus musculus) 6480464 Acetaminophen affects the expression of TOLLIP mRNA CTD PMID:17562736 Tollip Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TOLLIP mRNA CTD PMID:33387578 Tollip Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TOLLIP protein CTD PMID:24521700 Tollip Rat paraquat multiple interactions ISO Tollip (Mus musculus) 6480464 rhyncophylline promotes the reaction [Paraquat results in increased expression of TOLLIP mRNA] more ... CTD PMID:33838153 Tollip Rat paraquat increases expression ISO Tollip (Mus musculus) 6480464 Paraquat results in increased expression of TOLLIP mRNA and Paraquat results in increased expression of TOLLIP protein CTD PMID:33838153 Tollip Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Tollip Rat pentanal decreases expression ISO TOLLIP (Homo sapiens) 6480464 pentanal results in decreased expression of TOLLIP mRNA CTD PMID:26079696 Tollip Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tollip (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOLLIP mRNA CTD PMID:36331819 Tollip Rat phenobarbital affects expression ISO Tollip (Mus musculus) 6480464 Phenobarbital affects the expression of TOLLIP mRNA CTD PMID:23091169 Tollip Rat propiconazole decreases expression ISO Tollip (Mus musculus) 6480464 propiconazole results in decreased expression of TOLLIP mRNA CTD PMID:21278054 Tollip Rat quercetin increases expression ISO Tollip (Mus musculus) 6480464 Quercetin results in increased expression of TOLLIP protein CTD PMID:23353651 Tollip Rat quercetin multiple interactions ISO Tollip (Mus musculus) 6480464 TOLLIP protein affects the reaction [Quercetin inhibits the reaction [lipopolysaccharide more ... CTD PMID:23353651 Tollip Rat Rhynchophylline increases expression ISO Tollip (Mus musculus) 6480464 rhyncophylline results in increased expression of TOLLIP mRNA and rhyncophylline results in increased expression of TOLLIP protein CTD PMID:33838153 Tollip Rat Rhynchophylline multiple interactions ISO Tollip (Mus musculus) 6480464 rhyncophylline promotes the reaction [Paraquat results in increased expression of TOLLIP mRNA] more ... CTD PMID:33838153 Tollip Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of TOLLIP protein CTD PMID:35544339 Tollip Rat serpentine asbestos increases expression ISO TOLLIP (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of TOLLIP mRNA CTD PMID:21148743 Tollip Rat silicon dioxide increases expression ISO TOLLIP (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of TOLLIP mRNA CTD PMID:19428942 Tollip Rat silver atom increases expression ISO TOLLIP (Homo sapiens) 6480464 Silver results in increased expression of TOLLIP mRNA CTD PMID:22342292 Tollip Rat silver(0) increases expression ISO TOLLIP (Homo sapiens) 6480464 Silver results in increased expression of TOLLIP mRNA CTD PMID:22342292 Tollip Rat sodium arsenite decreases expression ISO Tollip (Mus musculus) 6480464 sodium arsenite results in decreased expression of TOLLIP mRNA CTD PMID:21911445 and PMID:31233874 Tollip Rat sodium arsenite multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOLLIP mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TOLLIP mRNA CTD PMID:39836092 Tollip Rat sodium arsenite increases expression ISO TOLLIP (Homo sapiens) 6480464 sodium arsenite results in increased expression of TOLLIP mRNA CTD PMID:38568856 Tollip Rat sodium chloride multiple interactions ISO TOLLIP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TOLLIP protein more ... CTD PMID:38598786 Tollip Rat sunitinib increases expression ISO TOLLIP (Homo sapiens) 6480464 Sunitinib results in increased expression of TOLLIP mRNA CTD PMID:31533062 Tollip Rat testosterone decreases expression ISO Tollip (Mus musculus) 6480464 Testosterone results in decreased expression of TOLLIP mRNA CTD PMID:21669218 Tollip Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TOLLIP mRNA CTD PMID:34492290 Tollip Rat thiram increases expression ISO TOLLIP (Homo sapiens) 6480464 Thiram results in increased expression of TOLLIP mRNA CTD PMID:38568856 Tollip Rat titanium dioxide decreases expression ISO TOLLIP (Homo sapiens) 6480464 titanium dioxide results in decreased expression of TOLLIP mRNA CTD PMID:22342292 Tollip Rat titanium dioxide decreases methylation ISO Tollip (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TOLLIP gene and titanium dioxide results in decreased methylation of TOLLIP promoter CTD PMID:35295148 Tollip Rat TMC-120A increases expression ISO Tollip (Mus musculus) 6480464 TMC 120A results in increased expression of TOLLIP mRNA CTD PMID:19818335 Tollip Rat trimethyltin increases expression ISO Tollip (Mus musculus) 6480464 trimethyltin results in increased expression of TOLLIP mRNA CTD PMID:21435392 Tollip Rat triptonide increases expression ISO Tollip (Mus musculus) 6480464 triptonide results in increased expression of TOLLIP mRNA CTD PMID:33045310 Tollip Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TOLLIP mRNA CTD PMID:19015723 Tollip Rat zinc protoporphyrin decreases expression EXP 6480464 zinc protoporphyrin results in decreased expression of TOLLIP protein CTD PMID:25780291 Tollip Rat zoledronic acid increases expression ISO TOLLIP (Homo sapiens) 6480464 zoledronic acid results in increased expression of TOLLIP mRNA CTD PMID:20977926
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) acrylamide (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) butanal (ISO) C60 fullerene (EXP) cadmium dichloride (EXP,ISO) cadmium selenide (ISO) carbamazepine (ISO) carbon nanotube (ISO) ceric oxide (ISO) chloroprene (EXP) clobetasol (ISO) corn oil (ISO) decabromodiphenyl ether (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) doxorubicin (EXP) endosulfan (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) erlotinib hydrochloride (ISO) ethanol (ISO) ferroheme b (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) heme b (ISO) indoles (EXP) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mesalamine (ISO) neoechinulin A (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) PCB138 (EXP) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) propiconazole (ISO) quercetin (ISO) Rhynchophylline (ISO) rotenone (EXP) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) TMC-120A (ISO) trimethyltin (ISO) triptonide (ISO) vinclozolin (EXP) zinc protoporphyrin (EXP) zoledronic acid (ISO)
Tollip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 206,391,120 - 206,413,809 (-) NCBI GRCr8 mRatBN7.2 1 196,961,585 - 196,984,252 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 196,950,771 - 196,983,625 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 205,305,293 - 205,326,118 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 212,423,637 - 212,444,459 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 205,097,793 - 205,118,619 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 214,823,993 - 214,844,861 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 214,823,978 - 214,844,858 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 221,737,397 - 221,758,265 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 202,008,799 - 202,029,669 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 202,170,336 - 202,189,385 (-) NCBI Celera 1 194,590,002 - 194,610,866 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI
TOLLIP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 1,274,371 - 1,309,632 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 1,274,371 - 1,309,654 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 1,295,601 - 1,330,862 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 1,252,177 - 1,287,415 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 1,252,176 - 1,287,415 NCBI Celera 11 1,332,006 - 1,366,839 (-) NCBI Celera Cytogenetic Map 11 p15.5 NCBI HuRef 11 1,087,157 - 1,122,196 (-) NCBI HuRef CHM1_1 11 1,294,507 - 1,328,900 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 1,345,549 - 1,381,261 (-) NCBI T2T-CHM13v2.0
Tollip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 141,435,317 - 141,456,198 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 141,428,550 - 141,472,244 (-) Ensembl GRCm39 Ensembl GRCm38 7 141,881,580 - 141,902,461 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 141,874,813 - 141,918,507 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 149,067,490 - 149,088,311 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 141,690,975 - 141,711,796 (-) NCBI MGSCv36 mm8 Celera 7 141,635,280 - 141,656,101 (-) NCBI Celera Cytogenetic Map 7 F5 NCBI cM Map 7 87.34 NCBI
Tollip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955476 10,987,223 - 11,010,808 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955476 10,987,223 - 11,009,134 (+) NCBI ChiLan1.0 ChiLan1.0
TOLLIP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 3,691,091 - 3,727,594 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 2,903,417 - 2,940,145 (-) NCBI NHGRI_mPanPan1
TOLLIP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 45,559,385 - 45,578,467 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 45,560,681 - 45,578,449 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 44,170,829 - 44,189,892 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 46,240,952 - 46,260,016 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 46,240,952 - 46,308,721 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 45,688,932 - 45,707,995 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 45,269,721 - 45,288,788 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 46,007,629 - 46,026,693 (-) NCBI UU_Cfam_GSD_1.0
Tollip
TOLLIP
TOLLIP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 1,094,535 - 1,127,342 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 1,094,582 - 1,125,045 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 98,226,602 - 98,258,983 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tollip
.
Predicted Target Of
Count of predictions: 773 Count of miRNA genes: 309 Interacting mature miRNAs: 409 Transcripts: ENSRNOT00000046344 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
RH133412
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,961,583 - 196,961,771 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,823,994 - 214,824,181 NCBI Rnor6.0 Rnor_5.0 1 221,737,398 - 221,737,585 UniSTS Rnor5.0 RGSC_v3.4 1 202,008,798 - 202,008,985 UniSTS RGSC3.4 Celera 1 194,590,001 - 194,590,188 UniSTS RH 3.4 Map 1 1436.9 UniSTS Cytogenetic Map 1 q41 UniSTS
BE112982
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,962,916 - 196,963,083 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,825,327 - 214,825,493 NCBI Rnor6.0 Rnor_5.0 1 221,738,731 - 221,738,897 UniSTS Rnor5.0 RGSC_v3.4 1 202,010,131 - 202,010,297 UniSTS RGSC3.4 Celera 1 194,591,334 - 194,591,500 UniSTS RH 3.4 Map 1 1437.51 UniSTS Cytogenetic Map 1 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046344 ⟹ ENSRNOP00000049498
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,961,585 - 196,982,451 (-) Ensembl Rnor_6.0 Ensembl 1 214,823,978 - 214,844,858 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103130 ⟹ ENSRNOP00000087930
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,961,580 - 196,983,625 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112102 ⟹ ENSRNOP00000089844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,950,771 - 196,982,451 (-) Ensembl
RefSeq Acc Id:
NM_001109668 ⟹ NP_001103138
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 206,391,122 - 206,411,988 (-) NCBI mRatBN7.2 1 196,961,585 - 196,982,451 (-) NCBI Rnor_6.0 1 214,823,995 - 214,844,861 (-) NCBI Rnor_5.0 1 221,737,397 - 221,758,265 (-) NCBI RGSC_v3.4 1 202,008,799 - 202,029,669 (-) RGD Celera 1 194,590,002 - 194,610,866 (-) RGD
Sequence:
GGCGGGGTCGGCTACTGCCGAGCTCTGTGCTTGGGGGAACGCCGAGGTGGGGCGAGGCGGGGCGACTGTCAGCTGACTAAAGAGCCGATTGCCTCGCGGGACAACGGTCAGCGACGCAGGTTGTGGTG
hide sequence
RefSeq Acc Id:
XM_039083484 ⟹ XP_038939412
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 206,391,120 - 206,411,975 (-) NCBI mRatBN7.2 1 196,961,586 - 196,982,447 (-) NCBI
RefSeq Acc Id:
XM_039083487 ⟹ XP_038939415
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 206,391,120 - 206,413,809 (-) NCBI mRatBN7.2 1 196,961,586 - 196,984,252 (-) NCBI
RefSeq Acc Id:
NP_001103138 ⟸ NM_001109668
- UniProtKB:
A2RUW1 (UniProtKB/Swiss-Prot), A6HY26 (UniProtKB/TrEMBL)
- Sequence:
MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGAVGTVGRLSITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMD
hide sequence
Ensembl Acc Id:
ENSRNOP00000049498 ⟸ ENSRNOT00000046344
RefSeq Acc Id:
XP_038939415 ⟸ XM_039083487
- Peptide Label:
isoform X2
- UniProtKB:
A6HY27 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038939412 ⟸ XM_039083484
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A889 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089844 ⟸ ENSRNOT00000112102
Ensembl Acc Id:
ENSRNOP00000087930 ⟸ ENSRNOT00000103130
RGD ID: 13690555 Promoter ID: EPDNEW_R1080 Type: initiation region Name: Tollip_1 Description: toll interacting protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 214,844,783 - 214,844,843 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Tollip
toll interacting protein
Tollip_predicted
toll interacting protein (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Tollip_predicted
toll interacting protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
