Acads (acyl-CoA dehydrogenase short chain)

Gene: Acads (acyl-CoA dehydrogenase short chain) Rattus norvegicus

Analyze

Symbol:

Acads

Name:

acyl-CoA dehydrogenase short chain

RGD ID:

620514

Description:

Enables butyryl-CoA dehydrogenase activity; identical protein binding activity; and nucleotide binding activity. Involved in fatty acid catabolic process; response to glucocorticoid; and response to starvation. Located in mitochondrial matrix and mitochondrial membrane. Human ortholog(s) of this gene implicated in alcohol use disorder and short chain acyl-CoA dehydrogenase deficiency. Orthologous to human ACADS (acyl-CoA dehydrogenase short chain); PARTICIPATES IN fatty acid beta degradation pathway; 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyacyl-CoA dehydrogenase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acetyl-Coenzyme A dehydrogenase, short chain; acyl-CoA dehydrogenase, C-2 to C-3 short chain; acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain; acyl-Coenzyme A dehydrogenase, short chain; butyryl-CoA dehydrogenase; Scad; short chain acyl-coenzyme A dehydrogenase; short-chain acyl-CoA dehydrogenase; short-chain specific acyl-CoA dehydrogenase, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACADS (acyl-CoA dehydrogenase short chain)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Acads (acyl-Coenzyme A dehydrogenase, short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Acads (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACADS (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACADS (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acads (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACADS (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACADS (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acads (acyl-CoA dehydrogenase short chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ACADS (acyl-CoA dehydrogenase short chain)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Acads (acyl-Coenzyme A dehydrogenase, short chain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	acads (acyl-CoA dehydrogenase short chain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arc42	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4860	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	acads	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Candidate Gene For:

Bw128 Foco6 Foco10

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	47,154,259 - 47,163,580 (+)	NCBI		GRCr8
mRatBN7.2	12	41,493,650 - 41,502,897 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,493,626 - 41,502,898 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	42,661,140 - 42,670,447 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	43,274,797 - 43,284,104 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,335,363 - 42,344,671 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	47,254,503 - 47,263,747 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	47,254,484 - 47,263,747 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	49,049,549 - 49,059,164 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	42,765,284 - 42,774,528 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	42,628,671 - 42,637,916 (+)	NCBI
Celera	12	43,112,383 - 43,121,613 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol use disorder (ISO)

congestive heart failure (ISO)

genetic disease (ISO)

maturity-onset diabetes of the young type 1 (ISO)

short chain acyl-CoA dehydrogenase deficiency (ISO,ISS)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

6-propyl-2-thiouracil (EXP)

acadesine (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

aspartame (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-hexachlorocyclohexane (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

choline (ISO)

clofibrate (EXP,ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

DDE (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

dioscin (EXP,ISO)

doxorubicin (ISO)

elemental selenium (ISO)

ethanol (EXP,ISO)

farnesol (ISO)

fenamidone (ISO)

fenofibrate (EXP)

flutamide (EXP)

folic acid (ISO)

fructose (EXP)

fulvestrant (ISO)

furan (EXP)

glafenine (EXP)

glycidol (EXP)

gold atom (ISO)

gold(0) (ISO)

guggulsterone (ISO)

GW 4064 (ISO)

GW 7647 (ISO)

hypochlorous acid (ISO)

indometacin (EXP)

isoprenaline (EXP)

ketoconazole (EXP)

L-methionine (ISO)

maneb (ISO)

melatonin (ISO)

methapyrilene (EXP)

methidathion (ISO)

mono(2-ethylhexyl) phthalate (EXP)

monosodium L-glutamate (ISO)

N-nitrosomorpholine (EXP)

oleic acid (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (EXP,ISO)

poly(I:C) (EXP)

propiconazole (ISO)

resveratrol (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (EXP)

sunitinib (ISO)

tert-butyl hydroperoxide (EXP,ISO)

testosterone (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

troglitazone (EXP)

urethane (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zinc atom (ISO)

zinc sulfate (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

butyrate catabolic process (IBA,IDA)

carboxylic acid catabolic process (IEA)

fatty acid beta-oxidation (TAS)

fatty acid beta-oxidation using acyl-CoA dehydrogenase (IBA,IDA,IEA,ISO)

response to glucocorticoid (IEP)

response to starvation (IEP)

Cellular Component

centrosome (IEA,ISO)

mitochondrial matrix (IDA,TAS)

mitochondrial membrane (IDA)

mitochondrion (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

Molecular Function

acyl-CoA dehydrogenase activity (IDA,IEA,ISO,NAS)

butyryl-CoA dehydrogenase activity (IBA,IDA,TAS)

fatty-acyl-CoA binding (IDA)

flavin adenine dinucleotide binding (IDA,IEA)

identical protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway (ISO)

3-hydroxyacyl-CoA dehydrogenase deficiency pathway (ISO)

3-hydroxyisobutyric aciduria pathway (ISO)

3-methylcrotonyl CoA carboxylase 1 deficiency pathway (ISO)

3-methylglutaconic aciduria type 1 pathway (ISO)

3-methylglutaconic aciduria type 3 pathway (ISO)

butanoate metabolic pathway (IEA,ISO)

carnitine palmitoyltransferase I deficiency pathway (ISO)

ethylmalonic encephalopathy pathway (ISO)

fatty acid beta degradation pathway (IDA,ISO)

fatty acid metabolic pathway (IEA,ISO)

glutaric aciduria type I pathway (ISO)

isobutyryl-CoA dehydrogenase deficiency pathway (ISO)

isovaleric acidemia pathway (ISO)

maple syrup urine disease pathway (ISO)

medium chain acyl-CoA dehydrogenase deficiency pathway (ISO)

methylmalonate semialdehyde dehydrogenase deficiency pathway (ISO)

methylmalonic acidemia pathway (ISO)

propionic acidemia pathway (ISO)

short-chain acyl-CoA dehydrogenase deficiency pathway (ISO)

trifunctional protein deficiency pathway (ISO)

valine, leucine and isoleucine degradation pathway (IEA,ISO)

very long-chain acyl-CoA dehydrogenase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional role of the active site glutamate-368 in rat short chain acyl-CoA dehydrogenase.	Battaile KP, etal., Biochemistry. 1996 Dec 3;35(48):15356-63.
2.	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.	Battaile KP, etal., J Biol Chem 2002 Apr 5;277(14):12200-7.
3.	The influence of chylomicron remnants on cholesteryl ester metabolism in cultured rat hepatocytes: comparison of the effects of particles enriched in n-3 or n-6 polyunsaturated fatty acids.	Botham KM, etal., Biochim Biophys Acta. 2001 Dec 30;1534(2-3):96-109.
4.	Treatment of metritis in cattle with prostaglandin F2 alpha.	Coulson A Vet Rec 1978 Oct 14;103(16):359.
5.	[Effect of truncal vagotomy on the exocrine function of the pancreas in the dog]	Dabrowski Z, etal., Pol Tyg Lek 1978 Jul 10;33(28):1093-5.
6.	Redesigning the active-site of an acyl-CoA dehydrogenase: new evidence supporting a one-base mechanism.	Dakoji S, etal., Bioorg Med Chem. 1997 Dec;5(12):2157-64.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Acyl-CoA dehydrogenases. A mechanistic overview.	Ghisla S and Thorpe C, Eur J Biochem. 2004 Feb;271(3):494-508.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Biosynthesis of four rat liver mitochondrial acyl-CoA dehydrogenases: in vitro synthesis, import into mitochondria, and processing of their precursors in a cell-free system and in cultured cells.	Ikeda Y, etal., Arch Biochem Biophys. 1987 Feb 1;252(2):662-74.
11.	Purification and characterization of short-chain, medium-chain, and long-chain acyl-CoA dehydrogenases from rat liver mitochondria. Isolation of the holo- and apoenzymes and conversion of the apoenzyme to the holoenzyme.	Ikeda Y, etal., J Biol Chem. 1985 Jan 25;260(2):1311-25.
12.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
13.	Importance of acyl-coenzyme A:cholesterol acyltransferase 1/2 dual inhibition for anti-atherosclerotic potency of pactimibe.	Kitayama K, etal., Eur J Pharmacol. 2006 Jul 1;540(1-3):121-30. Epub 2006 Apr 29.
14.	Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.	Kovanen L, etal., Alcohol Alcohol. 2010 Jul-Aug;45(4):303-11. doi: 10.1093/alcalc/agq035. Epub 2010 Jun 16.
15.	Molecular cloning and nucleotide sequence of cDNAs encoding the precursors of rat long chain acyl-coenzyme A, short chain acyl-coenzyme A, and isovaleryl-coenzyme A dehydrogenases. Sequence homology of four enzymes of the acyl-CoA dehydrogenase family.	Matsubara Y, etal., J Biol Chem 1989 Sep 25;264(27):16321-31.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Developmental, nutritional, and hormonal regulation of tissue-specific expression of the genes encoding various acyl-CoA dehydrogenases and alpha-subunit of electron transfer flavoprotein in rat.	Nagao M, etal., J Biol Chem. 1993 Nov 15;268(32):24114-24.
18.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
20.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
21.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
22.	A novel short-chain alcohol dehydrogenase from rats with retinol dehydrogenase activity, cyclically expressed in uterine epithelium.	Rexer BN and Ong DE, Biol Reprod 2002 Nov;67(5):1555-64.
23.	GOA pipeline	RGD automated data pipeline
24.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
26.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:3597357	PMID:11134486	PMID:14651853	PMID:16729965	PMID:18614015	PMID:21630459	PMID:25636810	PMID:25753319	PMID:26316108	PMID:26989860	PMID:29867124	PMID:31505169
PMID:36883465

Genomics

Comparative Map Data

Acads
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	47,154,259 - 47,163,580 (+)	NCBI		GRCr8
mRatBN7.2	12	41,493,650 - 41,502,897 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,493,626 - 41,502,898 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	42,661,140 - 42,670,447 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	43,274,797 - 43,284,104 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,335,363 - 42,344,671 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	47,254,503 - 47,263,747 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	47,254,484 - 47,263,747 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	49,049,549 - 49,059,164 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	42,765,284 - 42,774,528 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	42,628,671 - 42,637,916 (+)	NCBI
Celera	12	43,112,383 - 43,121,613 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

ACADS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	120,725,826 - 120,740,008 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	120,725,774 - 120,740,008 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	121,163,629 - 121,177,811 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	119,648,050 - 119,662,193 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	119,626,385 - 119,640,530	NCBI
Celera	12	120,797,834 - 120,812,046 (+)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	118,172,924 - 118,187,098 (+)	NCBI		HuRef
CHM1_1	12	121,132,346 - 121,146,588 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	120,714,964 - 120,729,131 (+)	NCBI		T2T-CHM13v2.0

Acads
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	115,248,358 - 115,257,405 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	115,248,358 - 115,257,405 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	115,110,299 - 115,119,346 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	115,110,299 - 115,119,346 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	115,560,308 - 115,569,322 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	115,371,298 - 115,380,312 (-)	NCBI		MGSCv36	mm8
Celera	5	112,206,409 - 112,215,487 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	55.99	NCBI

Acads
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	10,928,560 - 10,942,926 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	10,928,560 - 10,942,748 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACADS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	128,794,025 - 128,810,226 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	128,790,398 - 128,806,613 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	118,309,303 - 118,323,489 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	121,682,113 - 121,696,376 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	121,682,113 - 121,696,376 (+)	Ensembl	panpan1.1		panPan2

ACADS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	16,572,936 - 16,584,760 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	16,572,947 - 16,584,194 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	16,574,053 - 16,587,252 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	16,837,490 - 16,850,715 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	16,837,499 - 16,850,713 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	16,798,031 - 16,811,155 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	16,873,738 - 16,886,985 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	16,916,088 - 16,929,300 (+)	NCBI		UU_Cfam_GSD_1.0

Acads
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	145,758,321 - 145,773,223 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936668	254,595 - 272,118 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936668	257,214 - 272,089 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACADS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	40,642,881 - 40,659,081 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	40,642,810 - 40,656,922 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	43,110,578 - 43,124,662 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	14	q16.2-q23.2	NCBI

ACADS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	116,083,156 - 116,096,554 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	116,083,276 - 116,096,607 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	129,000,614 - 129,013,678 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acads
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	12,955,118 - 12,966,242 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	12,954,635 - 12,966,320 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Acads
37 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	186
Count of miRNA genes:	128
Interacting mature miRNAs:	139
Transcripts:	ENSRNOT00000001556
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

RH134326

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,502,526 - 41,502,724 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	47,263,377 - 47,263,574	NCBI	Rnor6.0
Rnor_5.0	12	49,058,793 - 49,058,990	UniSTS	Rnor5.0
RGSC_v3.4	12	42,774,158 - 42,774,355	UniSTS	RGSC3.4
Celera	12	43,121,243 - 43,121,440	UniSTS
RH 3.4 Map	12	777.83	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	68	35	36	11	8
Low									6		5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J05030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001556 ⟹ ENSRNOP00000001556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	41,493,626 - 41,502,898 (+)	Ensembl
Rnor_6.0 Ensembl	12	47,254,484 - 47,263,747 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098620 ⟹ ENSRNOP00000093188

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	41,494,674 - 41,502,898 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102388 ⟹ ENSRNOP00000084893

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	41,493,631 - 41,502,897 (+)	Ensembl

RefSeq Acc Id:

NM_022512 ⟹ NP_071957

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	47,154,333 - 47,163,579 (+)	NCBI
mRatBN7.2	12	41,493,650 - 41,502,897 (+)	NCBI
Rnor_6.0	12	47,254,503 - 47,263,747 (+)	NCBI
Rnor_5.0	12	49,049,549 - 49,059,164 (+)	NCBI
RGSC_v3.4	12	42,765,284 - 42,774,528 (+)	RGD
Celera	12	43,112,383 - 43,121,613 (+)	RGD

Sequence:

show sequence

TCAGGAGGTCCCGGAGGTCTGTGCCCATGGCCATGGCCGCTGCGTTGCTCGCCCGGGCCGGTGG
CTCTCTCGGCAGAGCTCTCCGCGCTCGAGATTGGCGAAGATTACATACTGTTTACCAGTCTGTG
GAACTACCTGAGACACATCAGATGTTGCGCCAGACATGCCGGGACTTTGCTGAGAAGGAGCTGG
TCCCCATCGCTGCCCAGCTGGACAAGGAACATCTCTTCCCCACATCGCAGGTGAAGAAGATGGG
GGAGCTCGGGCTGCTGGCCATGGATGTGCCAGAGGAGCTGAGTGGTGCTGGCCTGGATTACCTG
GCCTACTCGATCGCCCTGGAGGAGATCAGCCGTGGCTGCGCCTCCACCGGAGTGATCATGAGTG
TCAACAACTCTCTCTACTTGGGACCCATCCTGAAGTTCGGATCCTCACAGCAGAAGCAGCAGTG
GATCACCCCTTTCACCAACGGTGACAAAATCGGCTGTTTTGCCCTCAGTGAGCCAGGCAATGGC
AGTGACGCGGGGGCCGCTTCCACCACTGCCCGGGAAGAGGGTGACTCCTGGGTCCTCAACGGCA
CCAAAGCCTGGATCACCAACTCCTGGGAGGCTTCTGCCACGGTGGTGTTTGCTAGCACCGACAG
GTCCCGGCAGAACAAGGGTATCAGCGCTTTCCTGGTTCCCATGCCAACTCCTGGGCTTACGCTG
GGCAAAAAGGAAGACAAGCTGGGCATCCGGGCCTCATCTACAGCTAACCTCATCTTTGAGGACT
GTCGCATCCCCAAGGAGAACCTGCTCGGCGAGCCTGGGATGGGCTTCAAGATAGCCATGCAAAC
CCTGGACATGGGCCGCATTGGCATCGCCTCCCAGGCCCTGGGTATTGCCCAGGCCTCCCTGGAT
TGTGCCGTGAAGTACGCCGAGAACCGCCATGCCTTTGGGGCACCCCTCACAAAGCTCCAAAACA
TCCAGTTCAAGCTGGCAGACATGGCCCTGGCCCTGGAGAGTGCCCGCCTGCTGACCTGGCGCGC
CGCCATGTTGAAGGACAATAAGAAGCCTTTCACCAAGGAGTCGGCCATGGCCAAGCTGGCTGCA
TCAGAGGCTGCTACTGCCATTAGCCACCAGGCCATCCAGATCCTGGGCGGCATGGGGTACGTGA
CAGAGATGCCAGCCGAGCGCTACTACCGAGATGCCCGCATCACTGAGATCTATGAAGGTACCAG
CGAAATCCAGAGACTGGTGATTGCCGGGCATCTGCTCCGGAGCTACCGGAGCTGAGCCCCCGCC
CTTCTTGGGAACTTGCCAGCCTGCTCAGACCATGAAGGGACCTGCCTCGGTCAGCCTTTCTGCC
CCTCACTGTAGCCCCCAGTCAGACTAGGGGAAAGTCTGTCTCAGGGAGAGGGAAGGTCAACCGC
TGTGACCTGTCAGCTCAGAATGGGGCGGCGTGGCTACCTCTTTACCCCCCACCAACAGTGCCTC
TCTCTTTGAGCGACCTGCTGGAGGCAGGGCCACAGAGACCTGAATGACCCTGGCCCTCCCAATG
CGGATGCCGTTCCCAAGAGTCCTCAGAGGCAAGAACAGGAGGGGCAGGGCGGGGTGAGGAGGGG
AAGGGGATGGCCCAGTGCTTGAGTCCCCAGGGTTGTCGTGGGAAGGCTGGGGAACCGGATCATA
GGGCCCTGGCTAGAGGTCAAGTGGCCGCAGGTGGTTCTGTGGCTGTAGAGCTGCCTGTGGTCAA
TAAAGCTCACCTGTGTCCTG

hide sequence

RefSeq Acc Id:

XM_063271614 ⟹ XP_063127684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	47,154,259 - 47,163,580 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071957	(Get FASTA)	NCBI Sequence Viewer
	XP_063127684	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40669	(Get FASTA)	NCBI Sequence Viewer
	AAH72545	(Get FASTA)	NCBI Sequence Viewer
	EDM13909	(Get FASTA)	NCBI Sequence Viewer
	EDM13910	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001556
	ENSRNOP00000001556.4
	ENSRNOP00000084893.1
	ENSRNOP00000093188.1
GenBank Protein	P15651	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071957 ⟸ NM_022512
- Peptide Label:	precursor
- UniProtKB:	P15651 (UniProtKB/Swiss-Prot), Q6IMX3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAMAAALLARAGGSLGRALRARDWRRLHTVYQSVELPETHQMLRQTCRDFAEKELVPIAAQLDK EHLFPTSQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRGCASTGVIMSVNNSLYLGP ILKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSWVLNGTKAWITNSW EASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLL GEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRHAFGAPLTKLQNIQFKLADMA LALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERYY RDARITEIYEGTSEIQRLVIAGHLLRSYRS hide sequence

RefSeq Acc Id:

ENSRNOP00000001556 ⟸ ENSRNOT00000001556

RefSeq Acc Id:

ENSRNOP00000093188 ⟸ ENSRNOT00000098620

RefSeq Acc Id:

ENSRNOP00000084893 ⟸ ENSRNOT00000102388

RefSeq Acc Id:	XP_063127684 ⟸ XM_063271614
- Peptide Label:	isoform X1
- UniProtKB:	F7F6Q6 (UniProtKB/TrEMBL)

Protein Domains

Acyl-CoA dehydrogenase/oxidase C-terminal Acyl-CoA dehydrogenase/oxidase N-terminal Acyl-CoA oxidase/dehydrogenase middle

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P15651-F1-model_v2	AlphaFold	P15651	1-412	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698702

Promoter ID:

EPDNEW_R9226

Type:

initiation region

Name:

Acads_1

Description:

acyl-CoA dehydrogenase short chain

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	47,254,466 - 47,254,526	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620514	AgrOrtholog
BioCyc Gene	G2FUF-18972	BioCyc
Ensembl Genes	ENSRNOG00000001177	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001556	ENTREZGENE
	ENSRNOT00000001556.5	UniProtKB/TrEMBL
	ENSRNOT00000098620.1	UniProtKB/TrEMBL
	ENSRNOT00000102388.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.540.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.40.110.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Butyryl-CoA Dehydrogenase, subunit A, domain 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7105799	IMAGE-MGC_LOAD
InterPro	Acyl-CoA_DH_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_Oxase/DH_cen-dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_Oxase/DH_mid-dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCo_DH-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCo_DH/oxidase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCoA_DH/ox_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCoA_DH/ox_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCoA_DH/oxidase_NM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64304	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91690	IMAGE-MGC_LOAD
NCBI Gene	64304	ENTREZGENE
PANTHER	ACYL-COA DEHYDROGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SHORT-CHAIN SPECIFIC ACYL-COA DEHYDROGENASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Acyl-CoA_dh_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_dh_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_dh_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Acads	PhenoGen
PIRSF	HsaA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ACYL_COA_DH_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACYL_COA_DH_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001177	RatGTEx
Superfamily-SCOP	SSF47203	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56645	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AJ45_RAT	UniProtKB/TrEMBL
	A0A8I6GC92_RAT	UniProtKB/TrEMBL
	A6J1X1_RAT	UniProtKB/TrEMBL
	ACADS_RAT	UniProtKB/Swiss-Prot
	F7F6Q6	ENTREZGENE, UniProtKB/TrEMBL
	P15651	ENTREZGENE
	Q6IMX3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-10-09	Acads	acyl-CoA dehydrogenase short chain	Acads	acyl-CoA dehydrogenase, C-2 to C-3 short chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-07-28	Acads	acyl-CoA dehydrogenase, C-2 to C-3 short chain	Acads	acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-08-29	Acads	acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain	Acads	acyl-Coenzyme A dehydrogenase, short chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Acads	acyl-Coenzyme A dehydrogenase, short chain	Acads	acetyl-Coenzyme A dehydrogenase, short chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Acads	acetyl-Coenzyme A dehydrogenase, short chain		acyl-coenzyme A dehydrogenase, short chain	Name updated	1299863	APPROVED
2005-01-20	Acads	acyl-coenzyme A dehydrogenase, short chain		short chain acyl-coenzyme A dehydrogenase	Name updated	1299863	APPROVED
2002-08-07	Acads	short chain acyl-coenzyme A dehydrogenase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the acyl CoA dehydrogenase family	631718

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)