Rrp15 (ribosomal RNA processing 15 homolog)

Gene: Rrp15 (ribosomal RNA processing 15 homolog) Mus musculus

Analyze

Symbol:

Rrp15

Name:

ribosomal RNA processing 15 homolog

RGD ID:

1332363

MGI Page

MGI

Description:

Predicted to be involved in maturation of 5.8S rRNA and maturation of LSU-rRNA. Predicted to be part of preribosome, large subunit precursor. Is expressed in several structures, including central nervous system; hair follicle; hemolymphoid system gland; submandibular gland; and testis. Orthologous to human RRP15 (ribosomal RNA processing 15 homolog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

2810430M08Rik; 5430437H21Rik; ribosomal RNA processing 15 homolog (S. cerevisiae); ribosomal RNA-processing protein 15; RRP15-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RRP15 (ribosomal RNA processing 15 homolog)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Rrp15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rrp15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RRP15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RRP15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rrp15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RRP15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RRP15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rrp15 (ribosomal RNA processing 15 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Rrp15 (ribosomal RNA processing 15 homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RRP15 (ribosomal RNA processing 15 homolog)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rrp15 (ribosomal RNA processing 15 homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F53E10.6	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG3817	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RRP15	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)

Related Pseudogenes:

Gm6447

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	186,453,283 - 186,481,555 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	186,453,175 - 186,481,555 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	186,721,086 - 186,749,358 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	186,720,978 - 186,749,358 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	188,544,965 - 188,573,237 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	188,421,880 - 188,452,712 (-)	NCBI		MGSCv36	mm8
Celera	1	193,664,585 - 193,683,559 (-)	NCBI		Celera
Cytogenetic Map	1	H5	NCBI
cM Map	1	89.95	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

gastrointestinal stromal tumor (ISO)

Loeys-Dietz syndrome 4 (ISO)

parathyroid carcinoma (ISO)

Usher syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (ISO)

(-)-alpha-phellandrene (ISO)

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

5-fluorouracil (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (EXP)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

coumarin (ISO)

coumestrol (ISO)

crotonaldehyde (ISO)

cyclosporin A (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

flutamide (ISO)

folic acid (EXP)

FR900359 (ISO)

genistein (EXP)

glafenine (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

methoxychlor (ISO)

methyl methanesulfonate (ISO)

nickel atom (ISO)

paracetamol (ISO)

phenobarbital (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium dichromate (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (ISO)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

maturation of 5.8S rRNA (IBA)

maturation of LSU-rRNA (IBA)

rRNA processing (IEA)

Cellular Component

preribosome, large subunit precursor (IBA)

Molecular Function

molecular_function (ND)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Database resources of the National Center for Biotechnology Information.	Wheeler DL, etal., Nucleic Acids Res 2001 Jan 1;29(1):11-6.

Additional References at PubMed

PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:12477932	PMID:12520002	PMID:12904583	PMID:14610273	PMID:15489334	PMID:15769876	PMID:16141072	PMID:16141073
PMID:16919269	PMID:17163456	PMID:18799693	PMID:21267068	PMID:21677750	PMID:21873635	PMID:24457600	PMID:28378742	PMID:32325033	PMID:36834940

Genomics

Comparative Map Data

Rrp15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	186,453,283 - 186,481,555 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	186,453,175 - 186,481,555 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	186,721,086 - 186,749,358 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	186,720,978 - 186,749,358 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	188,544,965 - 188,573,237 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	188,421,880 - 188,452,712 (-)	NCBI		MGSCv36	mm8
Celera	1	193,664,585 - 193,683,559 (-)	NCBI		Celera
Cytogenetic Map	1	H5	NCBI
cM Map	1	89.95	NCBI

RRP15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	218,285,293 - 218,337,983 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	218,285,293 - 218,337,983 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	218,458,635 - 218,511,325 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	216,525,252 - 216,577,948 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	191,675,091 - 191,727,786 (+)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI
HuRef	1	189,126,828 - 189,179,495 (+)	NCBI		HuRef
CHM1_1	1	219,730,946 - 219,783,677 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	217,520,058 - 217,572,747 (+)	NCBI		T2T-CHM13v2.0

Rrp15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	100,807,729 - 100,830,812 (-)	NCBI		GRCr8
mRatBN7.2	13	98,276,276 - 98,299,357 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	98,276,134 - 98,299,370 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	100,793,786 - 100,816,887 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	102,180,954 - 102,204,035 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	99,376,101 - 99,399,202 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	105,155,824 - 105,178,907 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	105,155,441 - 105,179,095 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	109,807,397 - 109,830,711 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	102,833,812 - 102,856,894 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	103,022,855 - 103,045,937 (-)	NCBI
Celera	13	97,784,470 - 97,807,553 (-)	NCBI		Celera
Cytogenetic Map	13	q26	NCBI

Rrp15
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	262,346 - 296,439 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	260,447 - 295,842 (-)	NCBI	ChiLan1.0	ChiLan1.0

RRP15
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	31,074,833 - 31,121,954 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	31,037,398 - 31,083,991 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	193,846,921 - 193,900,077 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	198,698,849 - 198,745,011 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	198,698,850 - 198,745,011 (+)	Ensembl	panpan1.1		panPan2

RRP15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	13,377,518 - 13,416,809 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	13,377,571 - 13,421,810 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	13,419,617 - 13,459,111 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	13,411,023 - 13,450,593 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	38	13,420,320 - 13,466,150 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	13,766,942 - 13,812,671 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	14,075,819 - 14,121,556 (+)	NCBI		UU_Cfam_GSD_1.0

Rrp15
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	58,391,000 - 58,446,398 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936628	408,911 - 456,425 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936628	408,854 - 456,464 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RRP15
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	8,253,822 - 8,303,860 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	8,253,798 - 8,296,143 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	10,300,927 - 10,339,246 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RRP15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	11,273,756 - 11,318,280 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	11,274,241 - 11,318,290 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	11,685,342 - 11,729,923 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rrp15
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624835	2,314,499 - 2,349,259 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624835	2,314,341 - 2,355,741 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rrp15
1035 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	387
Count of miRNA genes:	278
Interacting mature miRNAs:	303
Transcripts:	ENSMUST00000001339, ENSMUST00000162336
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054490	Opefa_m	open field activity (mouse)			Not determined		1	153712853	187712853	Mouse
10766456	Sle21_m	systematic lupus erythematosus susceptibility 21 (mouse)					1	155831765	189831892	Mouse
1301189	Lmr8_m	leishmaniasis resistance 8 (mouse)			Not determined		1	156602037	189303617	Mouse
12880426	V25Dq2_m	vitamin D inactive form serum level QTL 2 (mouse)					1	172532197	195154279	Mouse
4141245	Cq2_m	cholesterol QTL 2 (mouse)			Not determined		1	157456299	191456436	Mouse
11059557	Lmr20a_m	leishmaniasis resistance 20a (mouse)					1	158468817	192468938	Mouse
1301339	Hdlq15_m	HDL QTL 15 (mouse)			Not determined		1	165873675	195154279	Mouse
1558802	Skmw6_m	skeletal muscle weight 6 (mouse)			Not determined		1	167954584	195154279	Mouse
1300745	Gvhd1_m	graft-versus-host disease 1 (mouse)			Not determined		1	157456299	191456436	Mouse
1301132	Mors1_m	modifier of obesity related sterility 1 (mouse)			Not determined		1	170379500	195154279	Mouse
1357692	Axtq1_m	anxiety QTL 1 (mouse)			Not determined		1	180832317	191851043	Mouse
4141034	Bmd1c_m	bone mineral density 1c (mouse)			Not determined			185909790	189303617	Mouse
10043963	Obq25_m	obesity QTL 25 (mouse)			Not determined		1	154410512	188410512	Mouse
1302132	Pbw1_m	pentobarbital withdrawal QTL 1 (mouse)			Not determined		1	155831765	189831892	Mouse
1301596	Elnt_m	escape latencies during navigation task (mouse)			Not determined		1	162145207	194111528	Mouse
1302158	Fembrs5_m	femur breaking strength 5 (mouse)			Not determined		1	167462514	195154279	Mouse
1301251	Scc3_m	colon tumor susceptibility 3 (mouse)			Not determined		1	168213823	195154279	Mouse
1300727	Mptp1_m	MPTP sensitivity 1 (mouse)			Not determined		1	171632048	192681050	Mouse
1302023	Orch4_m	autoimmune orchitis resistance 4 (mouse)			Not determined		1	175211318	195154279	Mouse
1301602	Bslm4_m	basal locomotor activity 4 (mouse)			Not determined		1	157456299	191456436	Mouse
1301202	Yaa4_m	Y-linked autoimmune acceleration 4 (mouse)			Not determined		1	158468817	192468938	Mouse
11059558	Lmr20c_m	leishmaniasis resistance 20c (mouse)					1	158468817	192468938	Mouse
1300823	Ath9_m	atherosclerosis 9 (mouse)			Not determined		1	160112768	194112883	Mouse
1357620	Aaj1_m	anxiety in A/J 1 (mouse)			Not determined		1	180832317	191851043	Mouse
11049575	Lmr8b_m	leishmaniasis resistance 8b (mouse)					1	172303451	195154279	Mouse
4141149	Hbnr4_m	Heligmosomoides bakeri nematode resistance 4 (mouse)			Not determined			147125258	188983224	Mouse
12904957	Gmmq1_m	gastrocnemius muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
1301619	Cafq1_m	caffeine metabolism QTL 1 (mouse)			Not determined		1	155716221	189716369	Mouse
12880429	V25Dq1_m	vitamin D inactive form serum level QTL 1 (mouse)					1	172632197	195154279	Mouse
10412074	Nhdlt1_m	non-HDL cholesterol and triglyceride levels 1 (mouse)			Not determined		1	153675990	187676105	Mouse
1301932	Ssta2_m	susceptibility to Salmonella typhimurium antigens 2 (mouse)			Not determined		1	155716221	189716369	Mouse
1301122	Cd8mts1_m	CD8 T memory cell subset 1 (mouse)			Not determined		1	155831765	189831892	Mouse
1301134	Bmd1_m	bone mineral density 1 (mouse)			Not determined		1	156602037	189303617	Mouse
4142389	Scfr1_m	stem cell frequency regulator 1 (mouse)			Not determined			171632048	189303617	Mouse
1301652	Cpfd2_m	cerebellum pattern fissures (mouse)			Not determined		1	172303451	195154279	Mouse
10412185	Hcs9_m	hepatocarcinogenesis susceptibility 9 (mouse)			Not determined		1	63854690	189303617	Mouse
1357618	Splq5_m	spleen weight QTL 5 (mouse)			Not determined		1	150193673	188359312	Mouse
1357493	Lgaq3_m	late growth adjusted QTL 3 (mouse)			Not determined		1	150193673	188359312	Mouse
1300948	Fglu2_m	fasting glucose 2 (mouse)			Not determined		1	157456299	191456436	Mouse
1559024	Zit1_m	zinc induced tolerance 1 (mouse)			Not determined		1	167462514	195154279	Mouse
1301722	Cia9_m	collagen induced arthritis QTL 9 (mouse)			Not determined		1	45783900	189303617	Mouse
1357485	Lgq4_m	late growth QTL 4 (mouse)			Not determined		1	150193673	188359312	Mouse
1301431	Pcho1_m	plasma cholesterol 1 (mouse)			Not determined		1	159262573	193262693	Mouse
4141483	Femwf7_m	femur work to failure 7 (mouse)			Not determined			167462514	195154279	Mouse
1301333	Mop3_m	morphine preference 3 (mouse)			Not determined		1	167756737	189303617	Mouse
10043863	Swrl5_m	SWR lupus locus 5 (mouse)			Not determined		1	172303451	195154279	Mouse
10412162	Nobq3_m	New Zealand obese QTL 3 (mouse)			Not determined		1	103933405	191225397	Mouse
12904936	Edlmmq1_m	extensor digitorum longus muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
12904944	Tammq1_m	tibialis anterior muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
12790988	Phdlc5_m	plasma HDL cholesterol 5 (mouse)					9	160097157	194097157	Mouse
12792983	Liq1_m	limb inflammation QTL 1 (mouse)					1	167586086	191225397	Mouse
4141165	Bglu3_m	blood glucose level 3 (mouse)			Not determined			155831765	189831892	Mouse
10402498	Lmr20_m	leishmaniasis resistance 20 (mouse)			Not determined		1	158468817	192468938	Mouse
1300888	Berr1_m	berghei resistance locus 1 (mouse)			Not determined		1	164143227	190534272	Mouse
4141244	Bmd5c_m	bone mineral density 5c (mouse)			Not determined			155526796	189526897	Mouse
1300842	Sle9_m	systematic lupus erythematosus susceptibility 9 (mouse)			Not determined		1	158468817	192468938	Mouse
11039528	Ccc3_m	colitis susceptibility in the Collaborative Cross 3 (mouse)					1	3680142	195051546	Mouse
10054271	Nba9_m	New Zealand Black autoimmunity 9 (mouse)			Not determined		1	155525623	189527533	Mouse
11081167	Tir8_m	trypanosome infection response 8 (mouse)					1	155716221	189716369	Mouse
1301866	Cplaq3_m	circadian period of locomotor activity 3 (mouse)			Not determined		1	155721528	189722608	Mouse
1301216	Cbm1_m	cerebellum weight 1 (mouse)			Not determined		1	157456299	191456436	Mouse
11059556	Lmr20b_m	leishmaniasis resistance 20b (mouse)					1	158468817	192468938	Mouse
12790987	Tgl5_m	triglyceride 5 (mouse)					1	160097157	194097157	Mouse
11532690	Sluc37_m	susceptibility to lung cancer 37 (mouse)					1	175468817	194111528	Mouse
1300732	Melm2_m	melanoma modifier 2 (mouse)			Not determined		1	157456299	191456436	Mouse
1301565	Mnotch_m	modifier of Notch (mouse)			Not determined		1	157456299	191456436	Mouse
1301632	Bw8q1_m	body weight at 8 weeks QTL 1 (mouse)			Not determined		1	161201261	195154279	Mouse
1357732	Tbbmd1_m	total body bone mineral density 1 (mouse)			Not determined		1	171983110	195154279	Mouse

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_026041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC154879	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK007616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK010658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK013204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK013217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK019950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK087997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK169088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC006787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466555	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO043575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000001339 ⟹ ENSMUSP00000001339

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	1	186,453,175 - 186,481,555 (-)	Ensembl
GRCm38.p6 Ensembl	1	186,720,978 - 186,749,358 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000162336

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	1	186,453,289 - 186,481,522 (-)	Ensembl
GRCm38.p6 Ensembl	1	186,721,092 - 186,749,325 (-)	Ensembl

RefSeq Acc Id:

NM_026041 ⟹ NP_080317

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	1	186,453,283 - 186,481,555 (-)	NCBI
GRCm38	1	186,721,086 - 186,749,358 (-)	ENTREZGENE
MGSCv37	1	188,544,965 - 188,573,237 (-)	RGD
Celera	1	193,664,585 - 193,683,559 (-)	RGD
cM Map	1		ENTREZGENE

Sequence:

show sequence

GTGTGTTGCAACACGACGGAATTATCAGGTGGCACTTCCGGCGAGCCAAGATGGCTGCGGCCGT
TCAGGACTCACGTGTGAGCCCAGGGGAGATACTGAAGCGTTCTCCGAAGAAGAAGAAAAAGATG
AAGATGGTAGCCAAGGCTGCAGCGTCGAAGCTAGAAGATGAGGTCAAAGACTCTTCTGATGGAG
AAGGAAGCTGTGACTCAGAGATGGACCACTCAGATGATGGAGCTGCAGAAGCAGACAGTGAGGA
CAATGTTGAATCCTGTGAGGAAGACAATGAAGACGCCGCAGAGTCGAGTGCTGGGACCAATTCA
GGCTGGGCAGATGCCATGGCAAAAATCCTTAACAAAAAGACTCCTAAAAGCAAAGCCACCATCC
TCACCAAAAACAAAGAGCTGGAGAAGGAGAAGGAGAAGCTAAAGCAGGAGAGGCTGGAGAAAAG
GAAGCAGCTTGATAAGAAGCGGGAGTGGGAAATGCTGTGCAGAGTGAAGCCAGATGTTGTCAAA
GACAAAGAGGCAGAGAGGAACCTTCAGAGGATTGCGACAAGGGGTGTGGTGCAGCTCTTCAATG
CTGTTCAGAAACACCAAAGGAATGTTGGCGAAAAGGTTAAGGAAGCAGGAGGCTCCGTCCGCAA
GCGAGCCAAGCTGATGTCAACTGTTTCCAAGAAGGATTTCATCAGTGTTCTTCGAGGAATGGAT
GGTACAAGTAGGAACAGTCCTGCTGGGAAGAGCCCCAAAGCCAGACAGACTGAAGTGAAATCAG
AAGAGAGCCCAGGGTGGAAGATTCTGCGAGATGATTTCATGATGGGAGCCAGCATGAAGGACTG
GGACAAGGAGAGCGAGGGCGAGGAGCCTGCTGGTGGCAGGGCAGAGGCCGCAGCCAGCCGTTGA
GCGGCAGACGGGAGCATCCAGCTCCGCTGCAAATGACCCGACGGTTGGGAGCCTGCGCATGGCC
ATCTGCCAAATGCTAGGACTTCCTGAGAACCTGTGCTCTAGGGTTCCTCAGGTGCAGACTGTAT
TAAAGCTGTATTTTTAATTCTTACAGAAATTTAACCTGTTTTTCTAAAATATTTGTACAGAGAA
ATATTTTTTTTCTTGAGCAGTAAACTGCAATTTTCTAGGATCCTTTGCTGTGGACACATGCCCA
TCATCCATCAGGGTTTCTAAAGTGCGGTCCCATTTATAATTAAAGTGAATTTGATATGAAAAAA
AAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_080317	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH06787	(Get FASTA)	NCBI Sequence Viewer
	BAB25137	(Get FASTA)	NCBI Sequence Viewer
	BAB27096	(Get FASTA)	NCBI Sequence Viewer
	BAB28719	(Get FASTA)	NCBI Sequence Viewer
	BAC40083	(Get FASTA)	NCBI Sequence Viewer
	BAE40872	(Get FASTA)	NCBI Sequence Viewer
	EDL13057	(Get FASTA)	NCBI Sequence Viewer
	EDL13058	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000001339
	ENSMUSP00000001339.6
GenBank Protein	Q9CYX7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_080317 ⟸ NM_026041

- UniProtKB:

Q9CWJ2 (UniProtKB/Swiss-Prot), Q922T8 (UniProtKB/Swiss-Prot), Q8BU28 (UniProtKB/Swiss-Prot), Q9D8W8 (UniProtKB/Swiss-Prot), Q9CYX7 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAAAVQDSRVSPGEILKRSPKKKKKMKMVAKAAASKLEDEVKDSSDGEGSCDSEMDHSDDGAAE
ADSEDNVESCEEDNEDAAESSAGTNSGWADAMAKILNKKTPKSKATILTKNKELEKEKEKLKQE
RLEKRKQLDKKREWEMLCRVKPDVVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAG
GSVRKRAKLMSTVSKKDFISVLRGMDGTSRNSPAGKSPKARQTEVKSEESPGWKILRDDFMMGA
SMKDWDKESEGEEPAGGRAEAAASR

hide sequence

RefSeq Acc Id:

ENSMUSP00000001339 ⟸ ENSMUST00000001339

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CYX7-F1-model_v2	AlphaFold	Q9CYX7	1-281	view protein structure

Promoters

RGD ID:

6876044

Promoter ID:

EPDNEW_M1473

Type:

multiple initiation site

Name:

Rrp15_1

Description:

Mus musculus ribosomal RNA processing 15 homolog , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	1	186,749,325 - 186,749,385	EPDNEW

RGD ID:

6818495

Promoter ID:

MM_KWN:3237

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

AK020767_A430105J06RIK, NM_026041, UC007DZR.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	1	188,573,051 - 188,573,551 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1914473	AgrOrtholog
Ensembl Genes	ENSMUSG00000001305	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000001339	ENTREZGENE
	ENSMUST00000001339.6	UniProtKB/Swiss-Prot
InterPro	Rrp15	UniProtKB/Swiss-Prot
KEGG Report	mmu:67223	UniProtKB/Swiss-Prot
MGD	MGI:1914473	ENTREZGENE
NCBI Gene	67223	ENTREZGENE
PANTHER	PTHR13245	UniProtKB/Swiss-Prot
	RRP15-LIKE PROTEIN	UniProtKB/Swiss-Prot
Pfam	Rrp15p	UniProtKB/Swiss-Prot
PhenoGen	Rrp15	PhenoGen
UniProt	Q8BU28	ENTREZGENE
	Q922T8	ENTREZGENE
	Q9CWJ2	ENTREZGENE
	Q9CYX7	ENTREZGENE
	Q9D8W8	ENTREZGENE
	RRP15_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q8BU28	UniProtKB/Swiss-Prot
	Q922T8	UniProtKB/Swiss-Prot
	Q9CWJ2	UniProtKB/Swiss-Prot
	Q9D8W8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-09-01	Rrp15	ribosomal RNA processing 15 homolog	Rrp15	ribosomal RNA processing 15 homolog (S. cerevisiae)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar