Advanced Search (OLGA)

Gene: Tmem30a (transmembrane protein 30A) Rattus norvegicus

Analyze

Symbol:

Tmem30a

Name:

transmembrane protein 30A

RGD ID:

1303315

Description:

Predicted to enable aminophospholipid flippase activity and structural molecule activity. Predicted to be involved in several processes, including phospholipid transport; positive regulation of cellular component organization; and xenobiotic transmembrane transport. Predicted to be located in early endosome membrane and late endosome membrane. Predicted to be part of phospholipid-translocating ATPase complex. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and plasma membrane. Orthologous to human TMEM30A (transmembrane protein 30A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cell cycle control protein 50A; MGC94262; P4-ATPase flippase complex beta subunit TMEM30A; similar to RIKEN cDNA 2010200I23

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM30A (transmembrane protein 30A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Tmem30a (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem30a (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem30a (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TMEM30A (transmembrane protein 30A)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tmem30a (transmembrane protein 30A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem30aa (transmembrane protein 30Aa)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem30ab (transmembrane protein 30Ab)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC50	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9947	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F20C5.4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	chat-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	LEM3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YNR048W	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem30a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	89,608,975 - 89,637,421 (-)	NCBI		GRCr8
mRatBN7.2	8	80,728,749 - 80,757,197 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	80,729,619 - 80,753,248 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	86,255,298 - 86,279,557 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	84,532,448 - 84,556,707 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	82,355,077 - 82,379,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	87,222,107 - 87,245,953 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	87,223,948 - 87,245,951 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	86,765,764 - 86,789,809 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	84,827,711 - 84,849,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	84,847,166 - 84,869,170 (-)	NCBI
Celera	8	80,456,004 - 80,478,007 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ullrich congenital muscular dystrophy 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

butanal (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

clofibric acid (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

diuron (ISO)

dorsomorphin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

folic acid (ISO)

formaldehyde (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead(0) (ISO)

methapyrilene (EXP)

methidathion (ISO)

methyl methanesulfonate (ISO)

methylphenidate (ISO)

miconazole (ISO)

N-nitrosodiethylamine (EXP)

p-toluidine (EXP)

paracetamol (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

Triptolide (EXP)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aminophospholipid translocation (IEA)

aminophospholipid transport (ISO)

lipid transport (IEA)

phospholipid translocation (IBA,ISO)

positive regulation of neuron projection development (IEA,ISO)

positive regulation of phospholipid translocation (IEA,ISO)

positive regulation of protein exit from endoplasmic reticulum (IEA,ISO)

protein localization to endosome (IEA,ISO)

xenobiotic transmembrane transport (IEA,ISO)

Cellular Component

apical plasma membrane (IEA)

early endosome membrane (IEA,ISO)

endoplasmic reticulum (IBA,IEA,ISO)

Golgi apparatus (IBA,IEA)

late endosome membrane (IEA,ISO)

membrane (ISO)

phospholipid-translocating ATPase complex (IEA,ISO,ISS)

photoreceptor inner segment (IEA)

photoreceptor outer segment (IEA)

plasma membrane (IBA,ISO)

transport vesicle membrane (IEA)

Molecular Function

aminophospholipid flippase activity (IEA,ISO)

protein binding (ISO)

structural molecule activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:19946888	PMID:20510206	PMID:21914794	PMID:22641037	PMID:22871113	PMID:23269685

Genomics

Comparative Map Data

Tmem30a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	89,608,975 - 89,637,421 (-)	NCBI		GRCr8
mRatBN7.2	8	80,728,749 - 80,757,197 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	80,729,619 - 80,753,248 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	86,255,298 - 86,279,557 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	84,532,448 - 84,556,707 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	82,355,077 - 82,379,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	87,222,107 - 87,245,953 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	87,223,948 - 87,245,951 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	86,765,764 - 86,789,809 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	84,827,711 - 84,849,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	84,847,166 - 84,869,170 (-)	NCBI
Celera	8	80,456,004 - 80,478,007 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

TMEM30A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	75,252,924 - 75,284,792 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	75,252,924 - 75,284,948 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	75,962,640 - 75,994,508 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	76,019,360 - 76,051,212 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	76,019,361 - 76,051,200	NCBI
Celera	6	76,356,050 - 76,388,034 (-)	NCBI		Celera
Cytogenetic Map	6	q14.1	NCBI
HuRef	6	73,161,451 - 73,193,435 (-)	NCBI		HuRef
CHM1_1	6	76,128,722 - 76,160,710 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	76,429,754 - 76,461,614 (-)	NCBI		T2T-CHM13v2.0

Tmem30a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	79,676,223 - 79,700,712 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	79,676,225 - 79,700,789 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	79,768,941 - 79,793,430 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	79,768,943 - 79,793,507 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	79,616,748 - 79,641,237 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	79,554,633 - 79,579,114 (-)	NCBI		MGSCv36	mm8
Celera	9	76,914,910 - 76,939,214 (-)	NCBI		Celera
Cytogenetic Map	9	E1	NCBI
cM Map	9	43.82	NCBI

TMEM30A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	95,299,954 - 95,332,044 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	93,177,736 - 93,209,830 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	73,096,128 - 73,128,202 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	76,387,063 - 76,419,282 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	76,390,241 - 76,418,939 (-)	Ensembl	panpan1.1		panPan2

TMEM30A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	36,898,136 - 36,932,189 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	36,888,092 - 36,931,936 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	36,775,533 - 36,811,838 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	37,600,304 - 37,636,641 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	37,599,568 - 37,636,452 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	37,003,886 - 37,040,195 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	36,995,300 - 37,031,351 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	37,123,319 - 37,159,632 (-)	NCBI		UU_Cfam_GSD_1.0

Tmem30a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	72,311,382 - 72,340,872 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936788	693,573 - 723,057 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936788	693,523 - 723,057 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM30A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	90,650,560 - 90,688,002 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	90,639,271 - 90,688,004 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	101,832,175 - 101,840,515 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM30A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	4,877 - 36,725 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	4,127 - 37,368 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	5,816,997 - 5,848,879 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem30a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624819	2,272,857 - 2,336,791 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmem30a
122 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	189
Count of miRNA genes:	131
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000015299
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	75311777	84531599	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	75311938	82925521	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015299 ⟹ ENSRNOP00000015299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,731,245 - 80,753,248 (-)	Ensembl
Rnor_6.0 Ensembl	8	87,223,948 - 87,245,951 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085725 ⟹ ENSRNOP00000070259

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,729,619 - 80,753,073 (-)	Ensembl
Rnor_6.0 Ensembl	8	87,224,341 - 87,245,774 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098005 ⟹ ENSRNOP00000084954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,731,242 - 80,753,073 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100089 ⟹ ENSRNOP00000088051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,731,245 - 80,753,248 (-)	Ensembl

RefSeq Acc Id:

NM_001004248 ⟹ NP_001004248

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,608,975 - 89,633,291 (-)	NCBI
mRatBN7.2	8	80,728,749 - 80,753,065 (-)	NCBI
Rnor_6.0	8	87,223,947 - 87,245,951 (-)	NCBI
Rnor_5.0	8	86,765,764 - 86,789,809 (-)	NCBI
RGSC_v3.4	8	84,827,711 - 84,849,715 (-)	RGD
Celera	8	80,456,004 - 80,478,007 (-)	RGD

Sequence:

show sequence

CAGGGTGCGTCCGCCTTTTCCCTCCCCCTTCCATCCTCCTCCCCCTCCCCTCCCCTCGTCCCTC
AATCTTCTCCCTATTTCCTCTCTCTCCCTCCCTGGGGCGTCTCCTGAAGACTCCCGCTTCCGGT
CAGCGGCCGTCCGCAGAAGCGTGTCCCGCCTCTTCCGCCTCCCCGGTGGCGGCGCGGGTGGCGG
AGGTAGTAGCGGCAGCGGCGACTGCGTGTCTCCTGTCAGGATCGGCAGGCAGGTCCTCTGGGCG
GCCCAGCTGGACGGGGCCGAGCCGAAGCCCGGGGGCCAATGGCGATGAACTATAGCGCGAAGGA
TGAGGTGGACGGCGGGCCCACGGGTCCTCCGGGGGGCGCCGCCAAGACCCGGAGGCCGGATAAC
ACGGCCTTCAAACAGCAACGGTTGCCTGCCTGGCAGCCCATCCTCACCGCCGGCACGGTGCTGC
CCACCTTCTTCATCATCGGCCTCATCTTCATTCCCATCGGCATCGGCATCTTCGTCACCTCCAA
CAACATCCGTGAGATCGAGGGCAATGTGTTTATGTATTATGGACTGTCTAATTTCTATCAAAAC
CATCGTCGTTATGTGAAATCCCGAGATGATAGCCAGTTAAACGGAGACCCTAGTGCTTTGCTTA
ATCCAAGTAAGGAATGTGAACCCTATCGAAGAAATGAAGACAAACCGATTGCTCCATGTGGGGC
CATTGCCAACAGCATGTTTAACGATACGTTAGAGTTGTTTCTGGTTGCCAATGAATCTGATCCC
AAGCCTGTGCCAATTCTTTTGAAGAAAAAAGGTATTGCTTGGTGGACAGATAAAAATGTGAAAT
TCAGAAATCCACCTGGAAAAGACAGCCTTCAAGAAAAGTTTAAAGATACAACAAAGCCAGTAAA
CTGGCATAAACCAGTATATGAGCTAGACCCTGATGATGAAAGTAATAATGGATTCATAAATGAA
GACTTTATTGTTTGGATGCGTACTGCAGCTTTACCTACTTTTCGTAAGTTATATCGTCTTATAG
AGCGGACAGATGATTTACACCCAACACTACCAGCTGGACAGTACTATTTGAACATCACATACAA
TTACCCTGTACATTTTTTTGATGGACGAAAACGGATGATCTTGAGCACTATTTCATGGATGGGA
GGAAAGAATCCATTTTTGGGAATTGCTTACATCACTATTGGATCCATCTCCTTCCTTCTGGGAG
TTGTACTGCTAGTAATTAATCATAAATATAGAAACAGTAGTAATACTGCTGACATCACCATTTA
ATTTTCTATTCTGAAACCAAATCTACTGCATGTGCATCAAGGCCAGTCCTGTTCAACCTAGCTT
TTGAATGCCGATGTCTGGTTAGTATGTCATTTTGAAGTTGGCACATAACAAAAAACAGCCTTTG
TTCTTTGCTTCTTACATATGGATGACTTATGAAAATATATGATGGGTATAAAAATTAGCCATAT
TGATTATATCAATATTATAACTGCTAAAATGACATTCTAATGTCTGCTCTTTATTGGGACAGGC
CATGTGATGCATAGAGCCTCTTTCATGTGAAATGCGTCTACTGCTTAAACTGTTTATGCTGTGT
GGATAACATTATATTGACATGATGCTGTATATGTGTGCCTACTGTGTGATGAAAGGGATTATGA
GATGTATGAGTGTAATGACTTGCTAACCTTTGAAAATTTGGTTACAGTTCAGATTGAAGAAAGA
CTAAATATAAATAAAACACTTCATCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399760 ⟹ NP_001386689

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,608,975 - 89,633,291 (-)	NCBI
mRatBN7.2	8	80,728,749 - 80,753,065 (-)	NCBI

RefSeq Acc Id:

XM_039081159 ⟹ XP_038937087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,609,630 - 89,637,419 (-)	NCBI
mRatBN7.2	8	80,731,238 - 80,757,197 (-)	NCBI

RefSeq Acc Id:

XM_063265186 ⟹ XP_063121256

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,609,630 - 89,637,421 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004248	(Get FASTA)	NCBI Sequence Viewer
	NP_001386689	(Get FASTA)	NCBI Sequence Viewer
	XP_038937087	(Get FASTA)	NCBI Sequence Viewer
	XP_063121256	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79203	(Get FASTA)	NCBI Sequence Viewer
	EDL77703	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015299.4
	ENSRNOP00000070259.1
	ENSRNOP00000084954.1
	ENSRNOP00000088051.1
	ENSRNOP00055005570
	ENSRNOP00060026169
	ENSRNOP00065015990
GenBank Protein	Q6AY41	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001004248 ⟸ NM_001004248
- Peptide Label:	isoform 2
- UniProtKB:	Q6AY41 (UniProtKB/Swiss-Prot), A0A8I6A8Z5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPI GIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNE DKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFRNPPGKDSLQEK FKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYRLIERTDDLHPTLPAG QYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNS SNTADITI hide sequence

Ensembl Acc Id:

ENSRNOP00000070259 ⟸ ENSRNOT00000085725

Ensembl Acc Id:

ENSRNOP00000015299 ⟸ ENSRNOT00000015299

RefSeq Acc Id:	XP_038937087 ⟸ XM_039081159
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000088051 ⟸ ENSRNOT00000100089

Ensembl Acc Id:

ENSRNOP00000084954 ⟸ ENSRNOT00000098005

RefSeq Acc Id:	NP_001386689 ⟸ NM_001399760
- Peptide Label:	isoform 1
- UniProtKB:	A0A0G2JXG3 (UniProtKB/TrEMBL), A6I1M4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063121256 ⟸ XM_063265186
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JXG3 (UniProtKB/TrEMBL), A6I1M4 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY41-F1-model_v2	AlphaFold	Q6AY41	1-328	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696156

Promoter ID:

EPDNEW_R6674

Type:

initiation region

Name:

Tmem30a_1

Description:

transmembrane protein 30A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	87,245,776 - 87,245,836	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303315	AgrOrtholog
BioCyc Gene	G2FUF-29739	BioCyc
Ensembl Genes	ENSRNOG00000010895	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055004654	UniProtKB/Swiss-Prot
	ENSRNOG00060018625	UniProtKB/Swiss-Prot
	ENSRNOG00065012746	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015299.6	UniProtKB/Swiss-Prot
	ENSRNOT00000085725.2	UniProtKB/TrEMBL
	ENSRNOT00000098005.1	UniProtKB/TrEMBL
	ENSRNOT00000100089.1	UniProtKB/TrEMBL
	ENSRNOT00055007413	UniProtKB/Swiss-Prot
	ENSRNOT00060032155	UniProtKB/Swiss-Prot
	ENSRNOT00065020784	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7131766	IMAGE-MGC_LOAD
InterPro	CDC50/LEM3_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:300857	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94262	IMAGE-MGC_LOAD
NCBI Gene	300857	ENTREZGENE
PANTHER	PTHR10926	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10926:SF17	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CDC50	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tmem30a	PhenoGen
PIRSF	DUF284_TM_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010895	RatGTEx
	ENSRNOG00055004654	RatGTEx
	ENSRNOG00060018625	RatGTEx
	ENSRNOG00065012746	RatGTEx
UniProt	A0A0G2JXG3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A2B0_RAT	UniProtKB/TrEMBL
	A0A8I6A8Z5	ENTREZGENE, UniProtKB/TrEMBL
	A6I1M4	ENTREZGENE, UniProtKB/TrEMBL
	CC50A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Tmem30a	transmembrane protein 30A	MGC94262	similar to RIKEN cDNA 2010200I23	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC94262				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar